Conserved Protein Domain Family
PRK07122

?
PRK07122: PRK07122 
RNA polymerase sigma factor SigF; Reviewed
Statistics
?
PSSM-Id: 168831
View PSSM: PRK07122
Aligned: 27 rows
Threshold Bit Score: 428.81
Threshold Setting Gi: 108799863
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118465934   4 AIAPTPTAARPTTq---SDDSYEDVVEMFLELRRMPAESHEYRRQRERIVARCLPLADHVASHFARRGEGLDDLVQVARL 80
gi 108799863   5 DDTLQVTAKRPSTr---TQDDYTDVPDMFRLLSVLSPGTPDHDRQRERIVTRCLPLADHIAFRYHRKGENLDDLVQIARV 81
gi 126435506   5 DDTLQVTAKRPSTr---TQDDYTDVPDMFRLLSVLSPGTPDHDRQRERIVTRCLPLADHIAFRYHRKGENLDDLVQIARV 81
gi 41407572    4 AIAPTPTAARPTSq---SDDSYEDVVEMFLELRRMPAESHEYRRQRERIVARCLPLADHVASHFARRGEGLDDLVQVARL 80
gi 118470482   1 -----------------MTSEYADVLDMFRELAGTTEGSPSYVRQREKIVERCLPLADHIARRFDGRGEPREDLVQVARV 63
gi 145225367   1 MTRSSSQGSSRSN------SEYSDVADMFRELAELEEGSAAFQRQRDRIVERCLPLADHIARRFDGRGEPRDDLVQVARV 74
gi 226305067   1 MTASADGPSRPRRr---STDEYRDVIPVFEEMRTLEPHSPEYERVRTALITRCLPLAEHIARRFDGRGEAHDDLVQVARL 77
gi 169629597   5 VDVPETGHSQVKPrvgrPTDDYADVPDMFRSLAGLAEHSDAYQRKHEEIVTRCLPLADNVARHFDRRGEDLEDLIQVARV 84
gi 226361251   1 MTSHTHSGGHTAR----WPDEYQDVTALFRQMAALDEDDPRRSRLRDAVVTRCLPLAEHIARRFDGRGEAHDDLVQVARL 76
gi 120402666   1 MTRSSSQGSSSRS-----GSEYADVAPMFRELAELEEGTAAFQRQRDRIVERCLPLADHIARRFDGRGEPRDDLVQVARV 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118465934  81 GLMNAVNRFDPAKGPSFIGFAVPTMMGEVRRYFRDYSWGMRVPRRLRELHVQISRTTADLAQQLGRAPNAGELSQVLEVP 160
gi 108799863  82 GLMHAVNRFDPENGANFLSFAVPTMLGEIRRHFRDNGWAMHVPRRLKDLHVQITRATPRLTQSLGRPPTPTDLAAELGAD 161
gi 126435506  82 GLMHAVNRFDPENGANFLSFAVPTMLGEIRRHFRDNGWAMHVPRRLKDLHVQITRATPRLTQSLGRPPTPTDLAAELGAD 161
gi 41407572   81 GLMNAVNRFDPAKGPSFIGFAVPTMMGEVRRYFRDYSWGMRVPRRLRELHVQISRTTADLAQQLGRAPNAGELSQVLEVP 160
gi 118470482  64 GLVNAVNRFDVEAGSDFVSFAVPTIMGEVRRHFRDNSWSVKVPRRLKELHLRLGAATAELSQRLGRAPTASELAHELDMD 143
gi 145225367  75 GLVNAVIRFDVTAGSDFVSFAVPTIMGEVRRHFRDNSWSVKVPRRLKELHLRLGAATAELSQRLGRAPTPSELAAELEMD 154
gi 226305067  78 GLVNAVDRFDSTRGSDFVSFAVPTVMGEVRRHFRDTGWALRVPRRMKELHFQLGQAISELSQQLGHAPTVDELAETLGIE 157
gi 169629597  85 GLLNAVNRFDPEKGASFLGFAVPTMMGEVRRHFRDHGWSLHVPRAIRDRHAQISRATAELTQELQRAPTAGELAAELGID 164
gi 226361251  77 GLVNSVDRFDVERGSDFVSFAVPTIMGEVRRHFRDTGWAVRVPRRMKELHLALSQAVAELSQSLGHAPTVSELAEHLDLE 156
gi 120402666  76 GLVNAVIRFDVNAGSDFVSFAVPTIMGEVRRHFRDNSWSVKVPRRLKELHLRLGAATAELSQRLGRAPTATELAAELEMD 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118465934 161 REEIVECLVAGDAYRLDSLDAPQGADSSGTpRSVADSVGDIDPQIEHITNREALRVLVATLPHREREVLRMRFFESMTQS 240
gi 108799863 162 RQEVVECLVAGDAYSLRSIDSPISSSDDTT-RSLADTLGEVDGEMEHITDRESLRPLLAALTERERTVISLRFFASMTQT 240
gi 126435506 162 RQEVVECLVAGDAYSLRSIDSPISSSDDTT-RSLADTLGEVDGEMEHITDRESLRPLLAALTERERTVISLRFFASMTQT 240
gi 41407572  161 REEIVECLVAGDAYRLDSLDAPQGADSSGTpRSVADSVGDIDPQIEHITNREALRVLVATLPHREREVLRMRFFESMTQS 240
gi 118470482 144 REEVVEGLIAGSSYNTLSIDSGGGG-DEEA-PAIVDTLGDLDMGLDQIDNRESLRPLLASLPERERTVLVLRFFESMTQT 221
gi 145225367 155 RDEVVEGLVAGSSYNTLSIDSGGGSGNEDA-PAIADTLGDVDLTLDQIENREALRPLLAALPERERTVLVLRFFESMTQT 233
gi 226305067 158 REEVAQALIAGNAYQTVSVDGAASN-HTDD-LPLVETLGDYDAALENVENHEALRPLLDKLPERERTVLMLRFFGNLTQT 235
gi 169629597 165 REEVVESLIAADAYQPQSIEAPLSHGDQES-KHLSDLLGNEDPALEHVTNREAVRPLLANLPLRERTVLELRFFKGMTQS 243
gi 226361251 157 QEEVAQGLLAGNAYQTVSVDNTSSD-RAGE-LSMVETLGDYDAAMDDVENHETLRPLLQSLPERERTVLMLRFFGNMTQT 234
gi 120402666 156 RDEVVEGLVAGSSYNTLSIDS-GGSGNEDA-PAIADTLGDVDLSLDQIENREALRPLLAALPERERTVLALRFFESMTQT 233
                        250       260
                 ....*....|....*....|....*....
gi 118465934 241 QIAERIGVSQMQVSRILANTLRCLRDQLE 269
gi 108799863 241 QIAERIGVSQMQVSRILAKTLQQLRDGMS 269
gi 126435506 241 QIAERIGVSQMQVSRILAKTLQQLRDGMS 269
gi 41407572  241 QIAERIGVSQMQVSRILANTLRCLRDQLE 269
gi 118470482 222 QIAERVGISQMHVSRLLAKSLARLRDQLQ 250
gi 145225367 234 QIAERVGISQMHVSRLLAKSLTRLRDQLE 262
gi 226305067 236 QIAEKVGVSQMHVSRLLAKTLSNLREQLD 264
gi 169629597 244 QIAAQIGVSQMHVSRILSDTLRYLREQMA 272
gi 226361251 235 QIADRVGISQMHVSRLLAKTLASLRDQLG 263
gi 120402666 234 QIAERVGISQMHVSRLLAKSLARLRDQLE 262
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap