Conserved Protein Domain Family
PRK07108

?
PRK07108: PRK07108 
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 180843
View PSSM: PRK07108
Aligned: 47 rows
Threshold Bit Score: 731.186
Threshold Setting Gi: 94984862
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15806445   10 MPEAVIVSTARTPIGKAYRGFLNDTHGSDLGAHAVKHAIERAGVNPADIEDVIMGAGNPEGATGSNIARQIALRAGLPVT 89 
94984862    1 MPEAVIVSTARTPIGKAYRGYLNDTHGSDIGAHVVRHAVERAGVHPAEVEDVLMGAGNPEGATGSNIARQIVLRAEFPVT 80 
120611543   1 MTSAVIVSTARTPLAKSWKGSFNMTHGATLGGHAVQHAVQRAGIDGAEVDDVIMGCANPEGATGANIARQIALRAGLPVT 80 
121594056   1 MTSAVIVSTARTPLAKSWKGSFNMTHGATLGGHAVQHAVQRAGIDPAAVDDVIMGCANPEGATGMNIARQIALKAGLPVT 80 
239815899   1 MTSAVIVSTARTPLAKSWKGAFNMTHGATLGGHAVQHAIARAGIEAAEVDDVIMGCATPEGATGSNIARQIALRAGCPVT 80 
91788434    1 MTSAVIVSTARTPLAKSWKGSFNMTHGATLGGHAVEHALKRAGIDAAEVDDVIMGCATPEGATGANIARQIALRAGCPVT 80 
121604745   1 MTSAVIVSTARTPLAKSWKGAFNMTHGATLGGHAVQHAMARAGIDAAEVDDVIIGCATPEGATGANIARQIALRAGCPVS 80 
160898755   1 MTSAVIVSTARTPLAKSWKGSFNMTHGATLGGHAVQHAVQRAGIDPAAVDDVIMGCANPEGATGMNIARQIALKAGLPIT 80 
124266966   1 MTKAVIVSTARTPLARSWKGAFNMTHGATLGGFAVQAAVQRAGIEPAEVEDVILGCAFPEGATGSNIARQVALRAGLPVT 80 
121608756   1 MTRAVIVSTARTPLTKSWKGSFNMTHGATLGGHAVQHAVARAGIEAAEVEDVIMGCANPEGATGSNIARQCALRAGLPIT 80 
15806445   90 VSGVTVNRFCSSGLNTIALAANHVMAGQGDVFVAGGLESISLTQNEhANTFHLRGEWLLEHKPDIYMSMLQTAEVVAERY 169
94984862   81 VPGVTVNRFCSSGLQTIALAANSIRAGEGEVIVAGGLESISLTQNEhANKYRLRGEWLMEHKPDIYMPMLETAEVVAKRY 160
120611543  81 TSGMTVNRFCSSGLQTIALAAQRIIAGEADVFVAGGVESISCVQQE-MNLHMLRDLELAKAKPEIYWSMLETAEQVAKRY 159
121594056  81 TSGMTINRFCSSGLQTIATAAQRIIAGEGEVYVAGGVESISCVQQE-MNLHMIQDLALAKQKPEIYWSMLQTAEQVAKRY 159
239815899  81 TSGMTINRFCSSGLQTIATAAQRIIAGEGEVYVAGGVESISCVQNE-ANKHMLADPWLVKHKPEIYWNMLQTAEQVAKRY 159
91788434   81 VSGMTVNRFCSSGLQTIALAAQRVIAGEADIYVAGGVESISCVQQE-MNTHMLQESWLAKNKPEIYWNMLQTAEQVAKRY 159
121604745  81 VSGMTVNRFCSSGLQAIALASQRIIAGEADIYVAGGVESISCVQQE-MNTHMLREDWLAKNKPEIYWNMLQTAEQVAKRY 159
160898755  81 ASGMTINRFCSSGLQTIATASQRIIAGEGDVYVAGGVESISCVQQE-MNLHMIQDLALAKQKPEIYWSMLQTAEQVAKRY 159
124266966  81 VSGLTVNRFCSSGLQSIALAAQRIVAGEGGTYVAGGVESISCVQNE-MNRHLLADPWLREHKPEIYWPMLQTAETVARRY 159
121608756  81 TAGMTVNRFCSSGLQTIALAAQRIISGEAEVFVAGGVESISCVQQE-MNQHMLRDPALTRQKPEIYWSMLQTAEQVAKRY 159
15806445  170 GISRERQDEYGYQSQMRTAAAQQAGKFDHEIVPMTATMKVQDKATGEISTQEVTRKLDEGNRPDTTLEGLAKLKPVFEGG 249
94984862  161 GISREAQDEYAYQSQMRTAAAQQQGLFDDEIVPFTATMKVQNKETGEISSREVTLTRDEGNRPDTTPEGLAKLKPVIEGG 240
120611543 160 HISRDAMDEYGAASQQKACAAQAAGKFDDEIAPITVTAGVADKTLG-LITKQVTVSKDEGTREGTTKEGISGIKPALPGG 238
121594056 160 HIGRDAMDEYGAASQQKACAAQAAGLFDAEIAPITVTAGIADKTLG-LITKQVTVSRDEGTREGTTKEGISGIRPAMPGG 238
239815899 160 NIGRDAMDEYGAASQQKATAALEAGRFKDEIAPITVLAGVADPVMG-LRTKEVTIENDEGIRPGTTKEGISGIRSAMPGG 238
91788434  160 NISRDRMDEYGALSQQKAAAALAAGRFEAEIAPITVTAGVADPVMG-LITKQVTVSKDEGIREGTTKEGISGIKPAIPGG 238
121604745 160 EISRERMDDYGAASQQKATAALAAGLFEAEIAPITVTMGVADPVMG-LMTKQVTVSQDEGIRAGTTKEGISGLRSAIPGG 238
160898755 160 GIGRDAMDEYGAASQQKACAAQAAGLLDAEIAPITVTMGVADKVRG-LITKEVTCSKDEGVREGTTKEGISGIRPALPGG 238
124266966 160 GIERERMDRYGAASQQKACAAQEAGRFADEIVAVTVTTGTADPVHG-VRSRDVTVSADEGLRHGTTYEAVAGIRSALPGG 238
121608756 160 GIGRQAMDEYGAASQQKACAAQAAGRFDAEIAPITVTTGVTDKTLG-LITRQVTVSRDEGTREGTTVEVISGLRPALPGG 238
15806445  250 VITAGNASQLSDGAAAVVVMNSDVARERGLQPLGVFKGFAVAGCEPDEMGIGPVLAVPKLLKRHGLSVDDIDLWELNEAF 329
94984862  241 VVTAGNASQLSDGAAAVVVMSDDLARERGLHPLGIFKGFAVAACEPDEMGIGPVFAVPKLLRRHGLTVDDIDLWELNEAF 320
120611543 239 VISAGNASQFSDGAGACVITSEDYASRKGLKPLGRFLGFAVAGCEPDEMGIGPVFAVPKVLKKLGLTVQDIDLWELNEAF 318
121594056 239 LISAGNASQFSDGAGACVVVGEDYAARNNLQPLGRFLGFAVAGCEPDEMGIGPVFAVPKVLKKLGLTVQDIDLWELNEAF 318
239815899 239 LISAGNASQFSDGGGACVVVDEKYAQQKGLKPLGRFLGFAVAGCEPDEMGIGPVFAIPKVLKRLGLTVNDIDLWELNEAF 318
91788434  239 VIAAGNASQFSDGGGAVVVMGEKVAEKKGLKPLGRFLGFAVAGCEPDEMGIGPVFAIPKVLAKLGLKISDIDLWELNEAF 318
121604745 239 LISAGNASQFSDGGGAVVVMDEKVAERKGLKPLGRFLGFAVAGCEPDEMGIGPVFAIPKVLAKLGLSVSDIDLWELNEAF 318
160898755 239 VISAGNASQFSDGAGACVVVSEDYASRNNLKPLGRFLGFAVAGCEPDEMGIGPVFAVPKVLKKLGLTVQDIDLWELNEAF 318
124266966 239 VVAAGNASQFSDGAGACVVMDEALAERRGLKPLGRFLGFAVAGCEPDEMGIGPVFAVPKLLQRLGLAVDDIDLWELNEAF 318
121608756 239 LVSAGNASQFSDGAGACVLTSEDYASKKGLQPLGRFLGFAVAGCEPDEMGIGPVFAVPKVLDKLGLAVSDIDLWELNEAF 318
15806445  330 AVQTLYCRDKLGIDPEKFNVNGGAISIGHPYGMSGARLTGHILLEGQRRGAKHVVVTMCVGGGMGAAGLFEVL 402
94984862  321 AVQAVYCRDKLGIDPEKYNVNGGSISIGHPYGMTGARLTGHILLEGKRRGAKHVVVTMCVGGGMGAAGLFEVL 393
120611543 319 AVQVLYCRDKLGIPADRLNVNGGAIALGHPYGVSGQRLTGHALIEGRRRGAKRVCVTMCIGGGMGAAGVFEVF 391
121594056 319 AVQVLYCRDKLGIPADRLNVNGGAIALGHPYGVSGQRLTGHALIEGKRRGAKRVCVTMCIGGGMGAAGVFEVL 391
239815899 319 AVQVIYCRDKLGIPGDRLNVDGGAIAVGHPYGVSGQRLTGHALIEGKRRGAKKVLVTMCIGGGMGAAGVFEVL 391
91788434  319 AVQVLYCADKLGIPMDRLNVNGGAIAVGHPYGVTGQRLTGHALIEGKRRGAKRVCVTMCIGGGMGAAGIYEVL 391
121604745 319 AVQVLYCADKLGIPMDRLNVNGGAIAVGHPYGVTGQRLTGHALIEGKRRGARRVCVTMCIGGGMGAAGVFEVL 391
160898755 319 AVQVLYCRDKLGIPNDRLNVNGGAIALGHPYGVSGQRLTGHALIEGKRRGAKRVCVTMCIGGGMGAAGVFEVL 391
124266966 319 AVQVLYCADRLGLPMERLNVNGGAIAVGHPYGVSGQRLVGHALLEGRRRGAKRVAVTMCIGGGMGAAGVFEVL 391
121608756 319 AVQVIYCRDRLGIPAQQLNVNGGAIAVGHPYGVSGQRLTGHALIEGKRRGARRVCVTMCIGGGMGAAGVFEVL 391
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap