Conserved Protein Domain Family
PRK07103

?
PRK07103: PRK07103 
polyketide beta-ketoacyl:acyl carrier protein synthase; Validated
Statistics
?
PSSM-Id: 180839
View PSSM: PRK07103
Aligned: 21 rows
Threshold Bit Score: 493.78
Threshold Setting Gi: 302868340
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
134101108   1 MNEVVVTGVGVLNSVADGPDSYAAALAAGRSGVRAADVAAEartSvgaWLDGFSVSAWADRQLRDDP--DADRLAA---V 75 
162451454   6 EPEAAITGVGVTSAIGQTRDAFARALLRGESAFGVMQRPGR---Q--------KGTAFLGAEIASLQ--VPEGMAPq--T 70 
154706534   3 MFPVYITGLGVQTSIGLSTKTFSAALRAGNCSIKRVSNYPElefPvlmAQLEGFNETLIASSLPGVS------------- 69 
154685415   8 TSDISITGIGVLTAVGQGKEAFLDALMEGRHAFDVMKRPGR---Q--------KGSSFIGAELSELT--PPDALSKr--L 72 
220908278   6 SLSPVVTGMGIVSAIGWNIDTFREALLAGRSQFTYLQRVGR---Q--------GTQPFIGAEIVEDA--LTDRLANygrL 72 
302868340   1 MSTVAVTGTGIVCAIGADVPSFTTAL-----------RAGR---SgvvGTADGLAAPITGWSFDDAVagVPEPLRRr--A 64 
83716629    1 MARAVVTGLGVVSPIGIGVPAFEAALFAGGAAFGVMRREGR----------QHAASAFLGAELPAFE--LPASAFA---G 65 
256424280   6 YKQPVITGIGITTASGQGKTSVTSSLLKGQTSFGIMQREGR---Q--------HTSAFIGAELGMLL--PPERIAPk--L 70 
305674446   6 LSEVVVTGLGVTAAIGQGKEDFASSLLSGRHAFDVLKRPGR---Q--------KDSRFSDTEIASLS--YPDRLSKk--L 70 
255767394   6 LPEVVVTGVGVTASIGQGKEDFASSLLSGRHAFDVMKRSGR---Q--------KDSRFIGAEIASLS--YPDRLSKk--M 70 
134101108  76 SR---RAALPARTAACAALAAVRHALL--GPEQRSGAALIVAGNNLALDYHADVLHRFRERPGSLRPSHALTHLDTDVVG 150
162451454  71 LR---KASFSARVALATLHEAWRDARL--DDVDPRRIGLIVGGSNVQQRDLVLAHEEYAGRADFLRPTYGVSFMDTDLCG 145
154706534  70 -----RLPYELQVTLAAAVEAWKDAGFmdHPPLSNRVGLVVTGDNLLPNLNFKYYKAFTNNPTYLSPKAITQCFDSYHLG 144
154685415  73 YR---RAALSGKTALIALYEAWHDAQL--DGADHSRTGLIIGGSNMTQRELLQAFEKNGETPQFVNPTYGLSFMDSDLSG 147
220908278  73 LR---GSSLSTQMALAVALEAWTTAKLslPATHPDRIGLVIGGSNINQRYQQQTWQHYQTHPEFLLPTYGLSVWDSDAVG 149
302868340  65 VRaaaRAPQPVRAAVAAALQAWTGAGLpgARIPGDRVGIVVAGHNLTARYTHELYRTWQDRPAYLPARFALHVQDTDHVG 144
83716629   66 AQ---RLSLPARAALAALGEAWADAAL--RELDPARVGLVIGGSNLQQRELARVHEAFRERPLYVRPNHAVSYMDTDLAG 140
256424280  71 FR---SASLSGKAALITLADAWEDAKL--DAVPPARIGLIVGGSNVQQREALLVHEKYRDRQRFITPAYGISFMDTDICG 145
305674446  71 LR---KASFSSRAALVTLSEAWEEAEL--DDTDSARIGLVVGGSNFQQRETLQLYESYQDRSSFISPSYGLSFMDSDLCG 145
255767394  71 LR---KASFSSRAALVTLTEAWEEAEL--DDADSSRIGLVVGGSNFQQRENFEVYERYQDRSGFISPAYGLSFMDSDLCG 145
134101108 151 VVSEVTGIAGEGWTAGAASASGTLAVILGARMVAAGETDTCLVVAPVSELSAAELRAFHDSGAMAGSHGTDEPWQVCRPF 230
162451454 146 FCTEQFGIRGLAYTAGGASASGQLAIIQAIQAVQAGHVDVCIALGALMDISFWECQGLASLGAMGSERHAAAPERACRPF 225
154706534 145 VISEVLNITGAGFVAGGASASGNIALIQAQQLLQQESLDACLVVGNFTHFSPIAIQAFYNSGALGGAHFIDHPNKASRPF 224
154685415 148 LCTEQFGIKGPAFTVGGASASGQAAVIQAAQGIKGGLFDRCIVIGALADLSYMECHALRSLGAMGTDTYAERPEAACRPF 227
220908278 150 VVSQALQIQGEGYTVGGASASGAIALIQAARQVQWGLTDISLAIGSLADLSSWECQGLINLGAMGSERFASQPHLACRPF 229
302868340 145 TLSEVLSATGEGFTVGGASASGNVGIVHAARLVAAGAVDCCVLVGAVTELTPMHHRGFAVLGALAEP--GGDPAAACRPF 222
83716629  141 ACAQAFGVRGAACTVGGASASGLLAVVEAARLVQAGELDACVAVGGLADLSHLECQAFRSLGAMGSERFADDPGAACRPF 220
256424280 146 LCTEQFGIRGHAYTLGAASASGQAAILQAVMAVESGQVDVCIALGALMDLSYWELQSFKSLGALGSERFASQPELACRPY 225
305674446 146 LCTDQFGITGLAYTVGGASASGQLAVIHAIQQVLSGEVDVCIALGALMDLSYMECEALRALGAMGTDKYADAPEKACRPF 225
255767394 146 ICTDQFGITGLAYTVGGASASGQLAVIHAIQQVLSGEVDTCIALGALMDLSYMECEALRALGAMGTDKYADEPENACRPF 225
134101108 231 DARRRGFVYGQGAAAVVLESRERAGRRGARRMAGIAGWGQRLDARRGTEPDPSGQAAAMRAALGRAGVEPAAVDYVNAHG 310
162451454 226 DRARDGFIYGECCGAVVVEALPRAARRGVRPYAWLSGWGIAMDANRNPDPSLDGEVEAIRRALRCAGCAPADIDYVNPHG 305
154706534 225 DKNRDGFILGEAAGAILLEKEKPTQRRS-TVYGKILSGSMALSATQSTAPDITAEVRVMRQTLSQTQLSPKDITYLNTHG 303
154685415 228 DRHTDGFIFGEACGAIVLERAESAEQRGARSWAGLKGWGMASDANRNPNPSAEGEMTVIRHALERAGLSAKEIDYINPHG 307
220908278 230 DQAADGFIYGESCGAVILENPIHAEQRNATIYGQLCGWGMVLDGNRHPNPNVIGEEKAMRAALTMAGLLPEQINYVNTHG 309
302868340 223 DHDRRGFVPGEAAAALVLEHPAAAARRGAAVLATVAGYALGLDANRLADPDSAGQARVIRAALAAAGLAPHEVDYVNAHA 302
83716629  221 DRARDGFIYGEACAALVVESPESAGRRGARARAALAGWSVVSGANRGPNATLDAEADAIGRALAHAGWRAADVDYVNPHG 300
256424280 226 DIDRDGFIYGESCGAVVIESNASSKARGVRHYAVLKGGAMYMDGHRNPDPSFEGESYVINHALQQAGITAAEIDYVNPHA 305
305674446 226 DQNRDGFIYGESCGALVIERKETAVRRGVKPYAALSGWSIKLDGNRNPDPSLEGEIHVIQEALKRAGLSPEEIDYINPHG 305
255767394 226 DQNRDGFIYGESCGALVIERKETALRRGLKPYAALSGWSIKLDGNRNPDPSLEGEIHVIQKALERARLLPEDIDYINPHG 305
134101108 311 TGSVVGDAAEARALaevFGPGN-RPLINSTKPLVGHCLASAGLQELVATILQLRGGFAHPNPNLAEPVDPALAFVGPT-A 388
162451454 306 TGSVVGDETELEAL---RACGLsHARLNATKSLVGHGLSAAGAVEVIATLLQMQEGRLHPSRNLDDPIDPSFNWVRGE-A 381
154706534 304 TSSLLGDVTEMAAIrtiFAEHLpKVWLNSTKSLIGHSLNSAGILEAIATIIQLKNNFLHPNINLDEPIDLQANWVGKKlV 383
154685415 308 TGSPIGDKTECRAL---SESGLsHARINATKSITGHGLSAAGTVEIIAALLQMRENKLHPIRNLTEPIDDSFQWVTDG-P 383
220908278 310 TGSPLGDQTEVAAL---KSVGLsHCWLNATKSLTGHGLSAAGVVEVITTLLQLQANCCHPTANLINPIDQTLQWVQEK-P 385
302868340 303 TGSRLGDETELAALhdvLGAAAgRPWVNATKALTGHCLGSAGVVEAVATVAQLTGGFVHPNPNLARPIDARIRFAGAG-P 381
83716629  301 SGSVSGDEIELAAL---AAAGLgHAWLNATKSLTGHALSAAGAVETLATVLQMQASRLHPTRNLDDPIAPA-RWVRGA-P 375
256424280 306 TGSRIGDETELDAL---RNCRLeHAFINTTKSVLGHGLTAAGCVELIAVLLQMEAGMLHPSVNLDNPIDNNFNWVRQQ-A 381
305674446 306 TGSYIGDEIELKAL---HACRLsHAYINATKSITGHGLSAAGIVEIISVLLQMREFALHPSRNLDHPIDDSFHWVNEK-S 381
255767394 306 TGSFIGDEIELKAL---RACRLsHAYINATKSITGHGLSAAGIVEIISVLLQMKKSALHPSRNLDHPIDDSFHWVNEK-S 381
134101108 389 RRGALHVALSNSVAFGGINAAIVV---RR 414
162451454 382 VAHTMKTALTLSMGFGGINTALCL---RK 407
154706534 384 ENIHNHYALSNSFGFFGIHTCLLL---EK 409
154685415 384 SAHTVHHALSLSMGFGGINTALCL---EN 409
220908278 386 ISARMNYALSNSFGFGGINTSLVLakeHS 414
302868340 382 EPARLRYALSTGFGFGGINTAVVL---AR 407
83716629  376 QPARVGRALKLSYGFGGINAALCL---EH 401
256424280 382 VTHQITHAITLSFGFGGMNTALVIsapl- 409
305674446 382 ISYRIKNALSLSMGFGGMNTAVCIkniEK 410
255767394 382 ISYRIKNALSLSMGFGGMNTAVCIqniEK 410
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap