Conserved Protein Domain Family
PRK07060

?
PRK07060: PRK07060 
short chain dehydrogenase; Provisional
Statistics
?
PSSM-Id: 180817
View PSSM: PRK07060
Aligned: 31 rows
Threshold Bit Score: 256.951
Threshold Setting Gi: 148553692
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
78061739    1 MKTRFDFGGSRVLVTGASSGIGRVCAVALAQAGAQVVAAGRDMAALDALAGETACETMRLDVGGDEhSIDAALAT-HDAF 79 
119384887   1 MRGTMQFSGKTVIITGAGKGIGRACARLMATRGAEVVALSRTQSDLDSLAAEIGARGIRVDLADPV-AARAAMAE-AGTA 78 
229591423   1 MNAAFNFTHHRILVTGASSGIGREIALQLIASGAEVFALGRDAQALAQL----GCHALCLDIADST-ALDNALQA-LPPL 74 
159186116   1 ----MQFSGKSVIITGAGKGIGRACAQLMAARGAEVVAISRTQSDLDSLKSEIGGRSIRVDLADIA-ATRAAMAE-AGPC 74 
86360455    1 ---MSDFTGKTVIITGAGKGIGRACVELLTHRGARIVALSRTQADLDDLAAKFGATVISVDLADNA-AARAAMKK-AGLA 75 
190895452   1 ---MSDFTGKTVIITGAGKGIGRACVELLAHRGARIVALSRTQADLDDLAAKFGATVISVDLADNA-AARAAMKK-AGLA 75 
300310400   1 ----MSFAGKTVIITGAGRGIGRACALLLAQRGAQVIALARTASDLARLQEEIGARVIAVDLSDPA-AARRAMAE-AGTA 74 
15966278    1 ----MEFSGKSVIVTGGGKGIGRATVALLAARGAQVVALSRTQSDLDELSSQTGCHGIVADLADAA-AARAAMVE-AGTC 74 
187925204   1 MNATFDFSGRSILVTGASSGIGRATVEALCASGANVVAAARNVSELARLAEETGCEPLVLDVSDEA-AIDDALGS-LDVF 78 
186475273   1 MNMTFDFSGRSILVTGASSGIGRTTVELLCASGAQVVAAARNVGELARLAEEAGCEPLVLDVGNEH-AIDEALGSlDVVF 79 
78061739   80 DGLVNCAGIASLESALEVSAAHFDRVMAVNARGAALVARAVARKMIaRDGRGaaqarGSIVNVSSQAALVGLPAHLSYCA 159
119384887  79 DYLVNSAGINVLESVLDMTEAGYEAVLGINLRAALICCQEFARGRV-AAGGG-----GAIVNITSIAGHRGFQDHLCYAA 152
229591423  75 HGLVNCAGISRLEPAAAISAEAFDQVMQVNARAAAQVGSRVAAKMI-EANIA-----GSIVNVSSQASLVALDDHLGYCA 148
159186116  75 DFLINSAGINVLESVLDMSDAGYEAVLGINLRAALVTCQEFARGRV-ANGGG-----GAIVNITSIAGHRGFQDHLCYAA 148
86360455   76 DALINCAGTNVLESVIDMTEEGYEQVLGINLRAALICAQEFARARI-SNGGG-----GTIVNVTSIAGHRGFVDHMAYAA 149
190895452  76 DALINCAGTNVLESVIDMTEEGYEQVLGINLRAALICAQEFARARI-ANGGG-----GTIVNVTSIAGHRGFVDHMAYAA 149
300310400  75 DFLINSAGINVLESVLEMSDEGYEAVLGVNLRAALITCQAFARMRI-AQGGG-----GAMVNITSIAGHRGFEQHLCYAA 148
15966278   75 DILVNCAGTNVLESLIDMTDDGYDVVMNTNLRAALICAQEFARARM-AAGGG-----GAIVNVTSIAGHRGFQNHVCYAA 148
187925204  79 DGLVNCAGIALLERAVDTTGASFDRVMAVNARGAVLVAKHVARGMI-DAQRG-----GSIVNVSSQAALVALDDHLSYSA 152
186475273  80 DGLVNCAGTTVLERAIDTTAASFDNVMNVNARGAALVARHVARGMI-GARRA-----GSIVNVSSQAALVGLEDHLSYCA 153
78061739  160 SKAAMDAITRVLCIELGPHGIRVNSVNPTVTLTPMAQFAWSEPEKRAPMLAAIPLGRFAEPDEVVEPILFLLSDAASMVS 239
119384887 153 SKAGLEGATRVLAKELGPHGIRVNAVAPTITLTELAAEAWSDPAKSQPMMVRHPLDRFAEAEEVAQGIALLLSEDSRMVS 232
229591423 149 SKAALDAITRVQCAEWGRFGIRVNSVNPTVTLTPMAAMAWSDPSKRDPALAAIPLGRFAETVEVALPVLFLLSSAASMIS 228
159186116 149 SKAGLEGATRVLAKELGPHGIRVNAVAPTITLTELAAEAWNDPEKSQPMMVRHPLNRFAEAEEVAQSIALLLSDDSKMIS 228
86360455  150 SKAGLEGATRVMARELGAYGIRVNAVAPTVTMTELAAKAWSEPSKRDPMIVRHPMARFAAVDDVARSIALLMSEDAPMIS 229
190895452 150 SKAGLEGATRVMARELGAYGIRVNAVAPTVTMTELAAKAWSEPSKRDPMIVRHPMARFAAVDDVARSIALLLSEDAPMIS 229
300310400 149 SKAGLEGATRVLARELGPHGIRVNAVAPTITLTELAEAAWSDPAKSGPMMARHPSARFASPEDVARSIAMLLSPDAAMLN 228
15966278  149 SKAGLEGATRVMAKELGPYGIRVVAIAPTITMTELAAAAWADPQKSEPMMVRHPAGRFATVDDVARSIAMLLSSDAEMVS 228
187925204 153 SKAALDAVTRALCVELGPFGIRVNSVNPTVTLTPMAVLAWSDPVKRDPALKAIPLGRFAESAEVAAPILFLLSGGASMIS 232
186475273 154 SKAAMDAITRVLCVELGGHGIRVNSVNPTVTLTPMAVKAWSEPFKRDPALQAIPLKRFAEPREVAEPILFLLSDAASMIS 233
78061739  240 GVSLPIDGGYTAR 252
119384887 233 GAVLPVDGGFLAV 245
229591423 229 GVSLPIDGGYTSR 241
159186116 229 GAVLPVDGGFLAV 241
86360455  230 GAVLPVDGGFLAV 242
190895452 230 GAVLPVDGGFLAV 242
300310400 229 GAVVPVDGGFLAV 241
15966278  229 GAVLPVDGGFLAV 241
187925204 233 GVCLAVDGGYTAR 245
186475273 234 GVALPIDGGYTAR 246
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap