Conserved Protein Domain Family
PRK07025

?
PRK07025: PRK07025 (this model, PSSM-Id:102677 is obsolete)
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 102677
View PSSM: PRK07025
Aligned: 31 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
115351779   1 MTDVVIVSAARTAVGKFGGSLAKIAAPELGATVIRAVLERSGVKPEQVSEVIMGQVLAAGSGQNPARQSLIKAGLPSAVP 80 
91783474    1 MTDVVIVSAARTAVGKFGGSLAKIAAPDLGAAVIRAVLERAGLKPEQVSEVILGQVLTAGSGQNPARQSLIKAGLPSAVP 80 
121600499   1 MTDVVIVSAARTAVGKSGGSLAKIAAPELGASVIRAVLERAGVKPEQVSEVILGQVLTAGSGQNPARQALIAAGLPNAVP 80 
113867452   1 MTDVVIVSAARTAVGKFGGSLAKIPAPELGAVVIKAALERAGVKPEQVSEVIMGQVLTAGSGQNPARQAAIKAGLPAMVP 80 
73541042    1 MTDIVIVSAARTAVGKFGGSLAKIPAPELGAIAIKAALERAGVKPEQVSEVIMGQVLTAGSGQNPARQASIKAGLPSSVP 80 
94310299    1 MTDIVIVSAARTAVGKFGGSLAKIPAPELGAIVIKAALERAGVKPDQVSEVIMGQVLTAASGQNPARQASRKAGLPDMVP 80 
124267058   2 TTDIVIVSAARTAVGKFGGTLAKTPAPELGAAVIQALLARSGLSGEQISEVILGQVLTAGSGQNPARQSVIKAGLPQGVP 81 
121605698   1 MEEIVIVSAGRTAVGKFGGSLAKIPATELGAAVIKAVLARSGLNAEQIGEVIMGQVLAAGAGQNPARQSVLKAGFPQGIP 80 
91788013    1 MEDIVIVSAGRTAVGKFGGSLAKMPATELGAAVIKAVLERSGLSAEQVGEVILGQVLAAGVGQNPARQAVIKAGFPHGIP 80 
17546351    1 MTDVVIVSAVRTAVGKFGGSLAKIPAPELGAAVIREALSRAKVAPDQVSEVIMGQVLTAGSGQNPARQALIKAGLPDMVP 80 
115351779  81 GMTINKVCGSGLKAVMLAANAIAAGDAEIVIAGGQENMSAAPHVLPGSRDGFRMGDAKLVDTMIVDGLWDVYNQYHMGIT 160
91783474   81 GMTINKVCGSGLKAVMLAANAIIAGDADIVIAGGQENMSAAPHVLPGSRDGFRMGDAKLVDSMIVDGLWDVYNQYHMGVT 160
121600499  81 GMTINKVCGSGLKAVMLAANAVVAGDAEIVVAGGQENMSAAPHVLPGSRDGFRMGDAKLVDSMIVDGLWDVYNKYHMGIT 160
113867452  81 AMTINKVCGSGLKAVMLAANAIMAGDAEIVVAGGQENMSAAPHVLPGSRDGFRMGDAKLVDTMIVDGLWDVYNQYHMGIT 160
73541042   81 AMTINKVCGSGLKAVMLAANAILAGEAEIVVAGGQENMSAAPHVLPGSRDGFRMGDAKLVDTMIVDGLWDVYNQYHMGIT 160
94310299   81 AMTINKVCGSGLKAVMLAANAIVAGEAEIVVAGGMENMSAAPHVLPGSRDGFRMGDTKLVDSMIVDGLWDVYNQYHMGIT 160
124267058  82 AMTINKVCGSGLKAVMLAAQAIRDGDAEIVIAGGQENMSLAPHVLPGSRDGQRMGDWKLIDTMIVDGLWDVYNQYHMGIT 161
121605698  81 GLTINAVCGSGLKAVMLAAQAVATGDSEIVIAGGQENMSASPHVLNGSRDGQRMGDWKMVDTMIVDGLWDVYNQYHMGIT 160
91788013   81 GLTINAVCGSGLKAVMLAAQSVATGDSEIVIAGGQENMSAAPHVLNGSRDGQRMGDWKMIDSMIVDGLWDVYNQYHMGIT 160
17546351   81 GMTINKVCGSGLKAVMLAANAIVAGDADIVVAGGQENMSAAPHVLPGSRDGFRMGDTKLIDSMIVDGLWDVYNQYHMGIT 160
115351779 161 AENVAKEYGITREEQDAFAALSQNKAEAAQKAGRFNDEIVPVSIPQRKGEPLQFATDEFVRHGVTAESLAGLKPAFAKEG 240
91783474  161 AENVAKEYGITREQQDAFAALSQNKAEAAQKSGRFDDEIVPIEIPQRKGEPLRFATDEFVRHGVTAESLAGLKPAFSKEG 240
121600499 161 AENVAKEYGITREAQDQFAALSQNKAEAAQKAGRFDDEIVPIEIPQRKGEPLRFATDEFVRHGVTAESLASLKPAFAKEG 240
113867452 161 AENVAKEYGITREAQDEFAVGSQNKAEAAQKAGKFDEEIVPVLIPQRKGDPVAFKTDEFVRQGATLDSMSGLKPAFDKAG 240
73541042  161 AENVAKEYGITREAQDEFAVASQNKAEAAQKAGKFDDEIVPVMIPQRKGDPVAFKTDEFVRQGATLDNMSGLKPAFDKAG 240
94310299  161 AENVAKEYGITRQAQDEFAVGSQNKAEAAQKAGKFDEEIVPVLIPQRKGDPVAFKTDEYVRQGATLESMASLKPAFDKTG 240
124267058 162 AENVAKKYGITREQQDALALGSQQKAAAAQDAGKFKDEIVPFSIAQKKGDPIVFAADEFINRKTNADVLAGLRPAFDKAG 241
121605698 161 AENVAKKYNINREAQDALALASQTKAAAAQDAGKFKDEIIPISIPQKKGDPLVFSADEFINRKTSAEGLAGLRPAFDKAG 240
91788013  161 AENVAKKYGIDRESQDALALASQTKAAAAQDAGKFKDEIIPISIPQKKGDPLVFAADEFINRKTNAEGLAGLRPAFDKAG 240
17546351  161 AENVAKQYGITREAQDAFAVASQNKAEAAQKSGRFNDEIVPILIPQRKGDPIAFAQDEFVRHGATLESMTGLKPAFDKAG 240
115351779 241 TVTAANASGLNDGAAAVLVMSAQKAAALGLTPLARIKAYANAGVDPSVMGMGPVPASRRALERAGWTPGDLDLMEINEAF 320
91783474  241 TVTAANASGLNDGAAAVLVMSAKKAEALGLTPLARIKAYANAGVDPKVMGMGPVPASRRCLERAGWTPADLDLMEINEAF 320
121600499 241 TVTAANASGINDGAAAVLVMSAKKAEALGLEPLARIKAYANAGVDPSVMGMGPVPASRRCLERAGWSVGDLDLMEINEAF 320
113867452 241 TVTAANASGLNDGAAAVVVMSAAKAKELGLTPLATIKSYANAGVDPKVMGMGPVPASKRALSRAEWTPQDLDLMEINEAF 320
73541042  241 TVTAANASGINDGAAAVVVMSAAKAKELGLTPLATIKAYANAGVDPKVMGMGPVPASKRCLSRAGWGVGDLDLMEINEAF 320
94310299  241 TVTAANASGLNDGAAAVVVMSAAKARELGLTPLATIKAYANAGVDPAVMGMGPVPASKRCLSRAGWEVKDLDLMEINEAF 320
124267058 242 GVTAGNASGLNDGAAAVLVMSAKKADQLGLKPLARIASYASAGLDPSLMGMGPVPASKRALERAGWKPADLDLLEINEAF 321
121605698 241 GVTAGNASGLNDGAAAVMVMTAKKAAALGLTPLARIASYATAGLDPAYMGMGPVPASTKALQRAGWNAQDLDLLEINEAF 320
91788013  241 GVTAGNASGLNDGAAAVMVMTAKKAAALGLKPLARIASYATTGLDPAYMGMGPVPASTKALKRAGWKAQDLDLLEINEAF 320
17546351  241 TVTAANASGLNDGGAAVVVMSAARAKELGLTPLATIRAYANAGVDPKVMGMGPVPASKRCLSRAGWSVGDLDLMEINEAF 320
115351779 321 AAQALAVHKQMGWDTSKVNVNGGAIAIGHPIGASGCRILVTLLHEMVKRDAKRGLASLCIGGGMGVALAVERP 393
91783474  321 AAQALAVHQQMGWDTSKVNVNGGAIAIGHPIGASGCRILVTLLHEMQKRDAKKGLASLCIGGGMGVALAVERA 393
121600499 321 AAQALAVHKQMGWDTSKVNVNGGAIAIGHPIGASGCRILVTLLHEMLKRDAKRGLASLCIGGGMGVALALERP 393
113867452 321 AAQALAVHQQMGWDTSKVNVNGGAIAIGHPIGASGCRILVTLLHEMKRRDAKKGLASLCIGGGMGVALAVERK 393
73541042  321 AAQALAVHQQMGWDTSKVNVNGGAIAIGHPIGASGCRILVTLLHEMKRRDAKKGLASLCIGGGMGVALAVERN 393
94310299  321 AAQALAVHQQMGWDQSKINVNGGAIAIGHPIGASGCRILVTLLHEMKRRDAKKGLASLCIGGGMGVALAVERN 393
124267058 322 AAQACAVNNEMGWDTSKVNVNGGAIAIGHPIGASGCRVLVTLLHEMQRRGSKRGIASLCIGGGMGVALTVER- 393
121605698 321 AAQACAVNQEMGWDTSKVNVNGGAIAIGHPIGASGCRILVTLLHEMVRRDAKKGIASLCIGGGMGVALTLER- 392
91788013  321 AAQACAVNKEMGWDTSKVNVNGGAIAIGHPIGASGCRILVTLLHEMARRDAKKGIASLCIGGGMGVALTLER- 392
17546351  321 AAQALAVHQQMGWDTAKVNVNGGAIAIGHPIGASGCRILVTLLHEMQKRDAKKGLASLCIGGGMGVALAVERP 393
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap