Conserved Protein Domain Family
PRK06954

?
PRK06954: PRK06954 
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 180775
View PSSM: PRK06954
Aligned: 24 rows
Threshold Bit Score: 678.151
Threshold Setting Gi: 238028775
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
121601234   1 MTAVDQDPIVIASAARTPIAGFQGEFASLAAPQLGAAAIAAALERAGLQPEQIDEAVMGCVLPAGQGQAPARQAALGAKL 80 
186474947   1 -MSETQDPVVIVSVARTPMAAFQGDFASLTAPQLGAIAIKAAVERAGLKPEQVEEAVIGCVLPAGQGQAPARQAALGAGL 79 
187922468   1 MSETKGDPIVIVGVARTPMAAFQGDFAALTAPQLGSVAIEAAVKRAGLKPEQVDEVVMGCVLPAGLGQAPARQAALGAGL 80 
17544995    1 ----MSDRIIIASAARTPMGAFQGELASLTAPQLGATAIRAAVERAGLKPEQIEEVIMGCVLPAGQGQAPARQAALGAGL 76 
300705371   1 ----MSDRIIIASAARTPMGAFQGELASLTAPQLGATAIRAAVERAGLKPEQIEEVIMGCVLPAGQGQAPARQAALGAGL 76 
300692753   1 ----MSDRIIIASAARTPMGAFQGELASLTAPQLGATAIRAAVERAGLKPEQIEEVIMGCVLPAGQGQAPARQAALGAGL 76 
187927234   1 ----MSDRIVIASAARTPMGAFQGELASLTAPQLGAAAIRAAVERAGLKPEQIEEVIMGCVLPAGQGQAPARQAALGAGL 76 
241661756   1 ----MSDRIVIASAARTPMGAFQGELASLTAPQLGAAAIRAAVERAGLKPEQIEEVIMGCVLPAGQGQAPARQAALGAGL 76 
73539844    1 ----MQDPIVIVSAARTPMAAFQGEFASLTAPQLGAVAIRAAVERAGIKPEQVEEVVFGCVLPAGQGQAPARQAALGAGL 76 
188590908   1 -----MEEIVIVSAARTPMAAFQGEFASVTAPQLGAVAIRAAVERAGLKPEQVEEVVFGCVLPAGQGQAPARQAALGAGL 75 
121601234  81 PLSVGCTTINKMCGSGMRAAMFAHDMLVAGSVDVIVAGGMESMTNAPYLLPKARAGMRMGHGQVLDHMFLDGLEDAYDKG 160
186474947  80 PLSTGSTTVNKMCGSGMRAAMFAHDMLSAGSVDVVVAGGMESMTNAPYLLPKARGGMRMGHGQVLDHMFLDGLEDAYEKG 159
187922468  81 PLATGSTTVNKMCGSGMRAAMFAHDMLAAGSVDVIVAGGMESMTNAPYLLPKARNGMRMGHGQVIDHMFYDGLEDAYEKG 160
17544995   77 PLSVGCTTVNKMCGSGMRAAMNAYDALLAGSVDVVVAGGMESMTNAPYLIPKGRGGYRIGHGMIYDHMMLDGLEDAYDKG 156
300705371  77 PLSVGCTTVNKMCGSGMRAAMNAYDALLAGSVDVVVAGGMESMTNAPYLIPKGRGGYRIGHGMIYDHMMLDGLEDAYDKG 156
300692753  77 PLSVGCTTVNKMCGSGMRAAMNAYDALLAGSVDVVVAGGMESMTNAPYLIPKGRGGYRIGHGMIYDHMMLDGLEDAYDKG 156
187927234  77 PLSVGCTTVNKMCGSGMRAAMNAYDALLAGSVDVVVAGGMESMTNAPYLIPKGRGGYRIGHGMIYDHMMLDGLEDAYDKG 156
241661756  77 PLSVGCTTVNKMCGSGMRAAMNAYDALLAGSVDVVVAGGMESMTNAPYLIPKGRGGYRIGHGMIYDHMMLDGLEDAYEKG 156
73539844   77 PLSVGCTTVNKMCGSGMRAAMNVYDGLVAGSFDIAVAGGMESMTNAPYLIPKGRGGYRIGHGMMYDHMMLDGLEDAYDKG 156
188590908  76 PLGTGCTTVNKMCGSGMRAAMTVYDGLVAGSFEIAVAGGMESMTNAPYLIPKGRGGYRIGHGMIYDHMMLDGLEDAYDKG 155
121601234 161 RLMGTFAEECAGEYAFSRDAQDAFAIESLARAKRANEDGSFAWEIAPVTVAGKKGDAVIARDEQPFKANPEKIPTLKPAF 240
186474947 160 RLMGTFAEECAGSFDFTREAQDKFAVESLMRAKRANEDGSFAWEIAPVTIEGKKGSVTVERDEQPFKANLDKIATLKPAF 239
187922468 161 RLMGTFAEECAASFDFTREAQDAFAVESLNRAKRANEDGSFGWEIAPVKVESRKGDVTIDRDEQPFKANPEKIPTLKPAF 240
17544995  157 RAMGTFGEDCAEKYGFTREAQDAFAMDSVRRAQAATESGAFRWEIAPVTVPGKAGDTVVDTDEGPRRIKVDKIPSLKPAF 236
300705371 157 RAMGTFGEDCAEKYGFTREAQDAFAIASVRRAQEATESGAFRWEIAPVTVSGKAGDTVVDTDEGPRRIKVDKIPSLKPAF 236
300692753 157 RAMGTFGEDCAEKYGFTREAQDAFAMASVRRAQEATESGAFRWEIAPVTVSGRAGDTLVDTDEGPRRIKVDKIPSLKPAF 236
187927234 157 RAMGTFGEDCAEKYGFTREAQDHFAMTSVRRAQEATESGAFRWEITPVTVSSKAGDTVIDTDEGPRRIKVDKIPSLKPAF 236
241661756 157 RAMGTFGEDCAEKYGFTREAQDHFAMTSVRRAQEATESGAFRWEITPVTVSSKAGDTVIDTDEGPRRIKVDKIPSLKPAF 236
73539844  157 RAMGTFGEDCAAKYGFTREQQDTFAIESVRRAQQATEAGDFRWEIAPVTVSGKGGDTVIDTDEGPRRIKTDKIPSLKPAF 236
188590908 156 RAMGTFGEDCAAKYGFTRQQQDEFAMESVRRAQQATENGDFRWEIAPVTVSGKGGDTVIDTDEGPRRIKLDKIPSLKPAF 235
121601234 241 SKTGTVTAANSSSISDGAAALVMMRASTANRLGLAPLARVVGHSTFAQAPSKFTTAPVGAIRRLFEKNGWRAAEVDLYEI 320
186474947 240 SKTGTVTAANSSSISDGAAALVMMRESTAKKLGVTPLARVVGHATFAQEPAKFTTAPVGAIRKLFEKNGWKADDVDLYEI 319
187922468 241 SKTGTVTAANSSSISDGAAALVMMRESTARRLGVEPIARVVGHSTFAQEPAKFTTAPVGAIRKLFEKNGWRADEVDLYEV 320
17544995  237 KKDGTVTAASSSSINDGAAALVMMRESTARQLGIAPLAVMLGHTTHAQAPGWFTTAPVTAIDKLFKKLGWSADSVDLFEI 316
300705371 237 KKDGTVTAASSSSINDGAAALVMMRESTAKQLGIAPLAVMLGHTTHAQAPGWFTTAPVTAIDKLFKKLGWNAANVDLFEI 316
300692753 237 KKDGTVTAASSSSINDGAAALVMMRESTARQLGITPLAVMLGHTTHAQAPSWFTTAPVTAIDKLFKKLGWNADNVDLFEI 316
187927234 237 KKDGTVTAASSSSINDGAAALVMMRESTAKQLGITPLAVMLGHTTHAQAPGWFTTAPVTAIDKLFKKLDWNSGNVDLFEI 316
241661756 237 KKDGTVTAASSSSINDGAAALVMMRESTAKQLGITPLAVMLGHTTHAQAPGWFTTAPVTAIDKLFKKLDWNSGNVDLFEI 316
73539844  237 AKDGTITAASSSSINDGASALVMMRESTAKKLGLRPIARMLGHTTHAQAPGWFTTAPVEAMAKLYRKLDWTTDSIDLFEI 316
188590908 236 AKDGTITAASSSSINDGASALVMMRASTAKKLGLQPIARMLGHTTHAQAPGWFTTAPVEAIAKLYRKLDWNTGSVDLFEI 315
121601234 321 NEAFAVVTMAAMKEHGLPHEKVNVNGGACALGHPIGASGARILVTLIGALRARGqARRGEPVHRRRRSDRDGHRADLT 398
186474947 320 NEAFAVVTMAAMKEHNLPHDKVNVNGGACALGHPIGASGARILVTLIGALRKRG-LKRGVASLCIGGGEATAMGVELF 396
187922468 321 NEAFAVVTMAAMKEHHLPHEKVNVNGGACALGHPIGASGARILVTLIGALKKRG-LKRGVATLCIGGGEATAMGIELV 397
17544995  317 NEAFAVVPMAAMHDLRIPHEKVNVNGGACALGHPIGASGARLIATLLGALRHRG-GKRGVASLCIGGGEATAVGIELL 393
300705371 317 NEAFAVVPMAAMHDLHIPHEKVNVNGGACALGHPIGASGARLIATLLGALRHRG-GKRGVASLCIGGGEATAVGIELL 393
300692753 317 NEAFAVVPMAAMHDLHIPHEKVNVNGGACALGHPIGASGARLIATLLGALRHRG-GKRGVASLCIGGGEATAVGIELL 393
187927234 317 NEAFAVVPMAAMHDLHIPHEKVNVNGGACALGHPIGASGARVIATLLGALQHRG-GKRGVASLCIGGGEATAVGIELY 393
241661756 317 NEAFAVVPMAAMHDLKIPHEKVNVNGGACALGHPIGASGARLIATLLGALQHRG-GKRGVASLCIGGGEATAVGIELY 393
73539844  317 NEAFAVVPMAAMHDLKIPREKVNIHGGACALGHPIGASGARIMTTLIGALRKTG-GKRGVASLCIGGGEATAVGIEIV 393
188590908 316 NEAFAVVPMAAMHDLKIPRDKVNIHGGACALGHPIGASGARIMTTLIGALRKTG-GKRGVASLCIGGGEATAVGIEIL 392
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap