Conserved Protein Domain Family
PRK06871

?
PRK06871: PRK06871 
DNA polymerase III subunit delta'; Validated
Statistics
?
PSSM-Id: 180738
View PSSM: PRK06871
Aligned: 16 rows
Threshold Bit Score: 542.789
Threshold Setting Gi: 15603539
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33152913    1 MALYPWLEQHYQQLTATFSNGRGHHALLFKSDVGLGTEKLIAQFAAWLLCQTPKQGHACDQCKSCLLLKNGNHPDLHILE 80
gi 261866744   2 IALYPWLTPVYQKITQAFEEGLGHHALLIRADEGLGAEQLCRLLAQRLMCLTPKGAEPCGECHACHLMQANSHPDFQHIA 81
gi 16272403    2 TALYPWLMPIYHQIAQTFDEGLGHHAVLIKADSGLGVESLFNALAQKIMCVA-QGDKPCGQCHSCHLMQAHSHPDYHELS 80
gi 68249055    2 TALYPWLMPIYHQIAQTFDEGLGHHAVLIKADSGLGVESLFNALAQKIMCVA-QGDKPCGQCHSCHLMQAHSHPDYHELS 80
gi 148825265   2 TALYPWLTPIYHQIAQTFDEGLGHHAVLIKADSGLGVESLFNALAQKIMCVA-QGDKPCGQCHSCHLMQAHSHPDYHELS 80
gi 148827650   2 TALYPWLMPIYHQIAQTFDEGLGHHAVLIKADSGLGVERLFDALTQKIMCVA-QGDKPCGQCHSCHLMQAHSHPDYHELS 80
gi 251793226   2 ISLYPWLAPTYHKITGAFDEALGHHALLLRADVGLGVAQLCEALAQRLMCLTPNGDEACGQCHSCHLMQANSHPDFQHIA 81
gi 15603539    2 MTLYPWLLPYYQQRIDAFQQGHGHHALLFQAEQGLGTEQLLFALGHWLICQQPQNQQPCQQCHHCHLFQAQTHPDIYTLT 81
gi 126209278   1 -MLYPWLQHTYQQLTESFLHGRGHHALLFKTDSGLGTETLIRHFAHWLLCQNPHREQACQQCKSCLLTAAGNHPDFHILE 79
gi 190151171   1 -MLYPWLQHTYQQLTESFLHGRGHHALLFKTDSGLGTETLIRHFAHWLLCQNPHREQACQQCKSCLLTAAGNHPDFHILE 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33152913   81 SIDGKDIGIEQIRETNTKLQNFAQQGGNTVVYIKNAECLTAASGNALLKTLEEPNDKVYFLLAAPQQTAILPTIASRCQT 160
gi 261866744  82 PIENKDIGVDQIRAMNEQASQHAQQNGNKVIYIEQAHRLTEAAANAILKTLEEPRPNTYFILQNDMQKALLPTIYSRCQV 161
gi 16272403   81 PINGKDIGVDQVRDINEMVAQHAQQNGNKVVYVQGAERLTEAAANALLKTLEEPRPNTYFLLQADSSASLLATIYSRCQV 160
gi 68249055   81 PIDGKDIGVDQVRDINEIVAQHAQQNGNKVVYVQGAERLTEAAANALLKTLEEPRSNTYFLLQTDSSASLLATIYSRCQV 160
gi 148825265  81 PIDGKDIGVDQVRDINEIVAQHAQQNGNKVVYVQGVERLTEAAANALLKTLEEPRPNTYFLLQADSSASLLATIYSRCQV 160
gi 148827650  81 PIDGKDIGVDQVRNINEMVAQHAQQNGNKVVYVQGAERLTEAAANALLKTLEEPRPNTYFLLQTDSSASLLATIYSRCQV 160
gi 251793226  82 PIENKDIGIDQIRAMNEQATQHAQQNGNKVIYIEQAHRLTEAAANAILKTLEEPRPNTYFILHCDIQTALLPTIYSRCQV 161
gi 15603539   82 PIENKDIGVDQVREVNEKINQHAQQGGNKIIYVLGVSRLTEAAANAMLKTLEEPRPNTYFLLYTEASDSVMPTIYSRCQT 161
gi 126209278  80 PIDGKDIGIDQVREANAKLQNFSQQGGNAVVYIRGAERLTEASSNALLKTLEEPHNSVYFLLEAPLQGAMLPTIQSRCQT 159
gi 190151171  80 PIDGKDIGIDQVREANAKLQNFSQQGGNAVVYIRGAERLTEASSNALLKTLEEPHNSVYFLLEAPLQGAMLPTIQSRCQT 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33152913  161 WLIHSPEMALTLAWLQAQAPTATReACE---------------------------IAMRLCHQRPLICKTFLEKDRLTAR 213
gi 261866744 162 WNLLPPATDTALHWLQTQTSAETS-EIL---------------------------TALLVNYGRPLLALAMLTQHLPEQR 213
gi 16272403  161 WNLSVPNEEIAFEWLKSKSAVENQ-EIL---------------------------TALAMNLGRPLLALETLQEGFIEQR 212
gi 68249055  161 WNLSVPNEQMAVDWLKSESAAENQ-EIL---------------------------TALAMNLGRPLLALETLQQGLIEQR 212
gi 148825265 161 WNLSVPNEQTAVDWLKSKSAVENQ-EIL---------------------------TALAMNLGRPLLALETLQEGFIEQR 212
gi 148827650 161 WNLSVPNEQMAVDWLKSESAAENQ-EIL---------------------------TALAMNLGRPLLALETLQQGLIEQR 212
gi 251793226 162 WNLLPPETEVALQWLQSQVSAETL-EMLfassptrlltpdgaigdanvqnpldfvTALRVNYGRPLLALAMLQQNQLEQR 240
gi 15603539  162 QKLALPAETSAIAWLQQQTTQEIA-AIQ---------------------------TALRISYGRPLHALTVLQQDLLEKR 213
gi 126209278 160 WLIHPPEMDIALDWLQANCSGVDFsSCE---------------------------IAMRLCHQRPLICKTFLENDRLQAR 212
gi 190151171 160 WLIHPPEMDIALDWLQANCSGVDFsSCE---------------------------IAMRLCHQRPLICKTFLENDRLQAR 212
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33152913  214 KTFLRTFWRFFNNRDVFLLFSQFDKEkaLILEQLEWLESFFSDSIKAKLAITNGWINHDLHNGILQFSQQLDIKRLLIGH 293
gi 261866744 214 REFLRQFWLFYRRRSPLELLPFFNKE--ILLQQLDWLLAFLSDSLKNKLAIQENWICRDIERGVIQFSQGLSAPALLKAT 291
gi 16272403  213 KNFLRQFWVFYRRRSPLELLPLFDKE--RYVQQVDWILAFLSDCLKHKLEIDSHRQVADLGRGIEQFSDEQTALGLLQAI 290
gi 68249055  213 KNFLRQFWVFYRRRSPLELLPLFDKE--RYVQQVDWILAFLSDCLKHKLEIDSHRQVADLGRGIEQFSDEQTALGLLQAI 290
gi 148825265 213 KNFLRQFWVFYRRRSPLELLPLFDKE--RYVQQVDWILAFLSDCLKHKLEIDSHRQVADLGRGIEQFSNEQTALGLLQAI 290
gi 148827650 213 KNFLRQFWVFYRRRSPLELLPLFDKE--RYVQQVDWILAFLSDCLKHKLEIDSYRQVADLGRGIEQFSDEQTALGLLQAI 290
gi 251793226 241 REFLRQFWVFYRRRSPLELFPFFAKEkdMALQQLDWLLAFLSDALKAKLQVKNGWICQDIERGVIQFAQGLSAPALLQAG 320
gi 15603539  214 REFLRQFWLFYRKRSPLELLPFFDKA--ILLHQLDWLLAFLSDALKAKLQIKSDWLCQDLAAGVLQLSQQQSAQALLHAT 291
gi 126209278 213 KTFLQTFWRFFKSRDVLLLFTAFDKEkeLVLQQLEWLDSFFADALKAKMDIAIGWTNPDLQAGILPFSQQLSVQALLKGH 292
gi 190151171 213 KTFLQTFWRFFKSRDVLLLFTAFDKEkeLVLQQLEWLDSFFADALKAKMDIAIGWTNPDLQAGILPFSQQLSAQALLKGH 292
                        330       340       350
                 ....*....|....*....|....*....|....*
gi 33152913  294 QLIQQTKWDLLAVNAINQELILLACLTKLTLNVFE 328
gi 261866744 292 QIVGKVRSDLAANNALNQELILLDGLTRLITEVFE 326
gi 16272403  291 KIMQKVRSDLLTINGVNVELMLLDGLTRLVTEVFE 325
gi 68249055  291 KIMQKVRSDLLTINGVNLELMLLDGLTRLVTEVFE 325
gi 148825265 291 KIMQQVRSDLLTINGVNVELMLLDGLMRLVTEVFE 325
gi 148827650 291 KIMQKVRSDLLTINGVNVELMLLDGLTRLVTEVFK 325
gi 251793226 321 NIVQKVRSDLQTINAVNQELILLDGLTRLITDVFE 355
gi 15603539  292 QIIQKVRTDLTQINAVNQELILLDGLTQLITDVFK 326
gi 126209278 293 QILQQTRQDLQQVNAMNLELMLLNYLTKLALETFE 327
gi 190151171 293 QILQQTRQDLQQVNAMNLELMLLNYLTKLALETFE 327
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap