Conserved Protein Domain Family
PRK06845

?
PRK06845: PRK06845 (this model, PSSM-Id:102590 is obsolete)
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 102590
View PSSM: PRK06845
Aligned: 10 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
86156492    6 QQDVVFLAAKRTPFGTFGGALKDLSATDLAVHAAKAAMAQAGAPPADYGHVVVGNVAQTSPDAIYLARHVGLRAGLPEGV 85 
15614560    1 MKDVVILDGARTPFTSFGGSFREVSAIELGVAAAKEAIKRANVDPEEVDQTIVGNVIQSSSDAILMGRHVGLKAGVRTET 80 
51891863    1 MEDVLILGGARTPFGTFGGALRDISAVDLGVAAARAALERTGVPAAAVDEVVVGNVIHTGKDGPYLARHIALYAGVPVET 80 
153002943   6 QKDVVILAAKRTPFGTFGGALKDHSATDLAVHAAGAAIAQAGVPAEDYGHVVMGNVVQTSPDAIYLARHVGLRAGLPQRV 85 
42522018    1 MEKIVFISGKRTPFGAFGGSLKDVSATDLGVAAAKATLEQAGLSADKIDHVVFGNVVQSGADAAYLPRHIGLKTGVPVAV 80 
108758110   7 NEEIYFLSGKRTPFGTYGGSLKDLSATDLAVESAKAALAQAKVSPEDVQHVVYGNVVQTSADAIYLPRHVGLRTGVPVPV 86 
45656296    1 MEEAVILDGIRTPFGNFGGTLKDLSAVDLGVLVSKTILERTGVSPEAIGESIFGNVIPTGKEAIYLARHIGLKTGLPLGV 80 
24213157    1 MEEAVILDGIRTPFGNFGGTLKDLSAVDLGVLVSKTILERTGVSPEAIGESIFGNVIPTGKEAIYLARHIGLKTGLPLGV 80 
116332305   1 MEEAVILDGIRTPFGNFGGTLKDLSAVDLGVLVSKAILEKTGVSPDGIGESIFGNVIPTGKEAIYLTRHIGLKSGLPLGI 80 
116327036   1 MEEAVILDGIRTPFGNFGGTLKDLSAVDLGVLVSKAILEKTGVSPDGIGESIFGNVIPTGKEAIYLTRHIGLKSGLPLGI 80 
86156492   86 PALTVNRLCGSGFEAVIEAARLVHTGEAELVLAGGTESMSQAPLVLRGTRF-GHAFGKTpQLEDMLWSALTDTYAGMPMA 164
15614560   81 TGLTINRLCGSGLQSILTAAESIRLGNSEVALAGGAENMSQIPHVIRGARW-GLPLGQA-KMEDYLWEALYDPYCDCTMA 158
51891863   81 PALTVNRLCGSGLQAAVSAAHTIRAGEASVALVGGVESMSQAPYHLRG-RF-GAGIGAP-ELGDALWETLTDSYCGCGMA 157
153002943  86 AALTVNRLCGSGFEAIIQAARLIELGEAELVLAGGTESMSQAPLVVRGTRF-GYAFGKPpAMEDMLWSAVTDSYAGMPMA 164
42522018   81 GAFAVNRLCGSGFQSWVNAVQMIQCGEATAVLAGGVEQMSQIPYVARKVRFdGMRMGNF-ELEDLMTSALTDAYAKMPMA 159
108758110  87 PALGVNRLCGSGFQAFITAAELMLTEQAAVVLAGGTESMSQAPHVIRGARW-GLPLGKG-SLEDMLWTALTDSYTGQPMA 164
45656296   81 PALTLNRLCGSGMEAIIQAAKKIYLGDADAVLAGGVESMSNAPYVVRNARW-GVRYGSA-EFEDTLEQGLTDQYVGLIMG 158
24213157   81 PALTLNRLCGSGMEAIIQAAKKIYLGDADAVLAGGVESMSNAPYVVRNARW-GVRYGSA-EFEDTLEQGLTDQYVGLIMG 158
116332305  81 PALTLNRLCGSGMEAIIQAAKKIYLGDADAVLAGGVESMSNAPYVVRNARW-GVRYGSV-EFEDTLEQGLTDQYVGLIMG 158
116327036  81 PALTLNRLCGSGMEAIIQAAKKIYLGDADAVLAGGVESMSNAPYVVRNARW-GVRYGSV-EFEDTLEQGLTDQYVGLIMG 158
86156492  165 LTAEKLAETHRIGQDAVDELAVASQRRWAAADEAGRFREELAPVELPSRKG-TVRFEKDEHPRpGTTLEGLRKLPKVFKA 243
15614560  159 ITAENLAEQYQITREEVDMFALRSHRLALESMRDGTFAKEIVAVNVKTKKG-ERMIDKDEHPR-ETTLEKLRNLVPRFKE 236
51891863  158 ITAENLAERYGISREEQDRFALLSQQRAAAARE--RLAEEIVPVELPARRGaPSRLEQDEHPRpDTTYEALARLPARFKE 235
153002943 165 LTAEKLAEQYALSQDEVDDYSVLSQRRWAAAHEAGRFREELAPLELKGRKG-PVAFERDEHPRpDTTVEGLRTLPKAFKK 243
42522018  160 ITAENLAVKYGITREESDKYSIQSQQRFQAAVEKGFMKQEICLVTVEGRKG-TVVIEKDEHPKpDSTLEKLATLKPVFKK 238
108758110 165 LTAEQLAVDYSLTQDQVDEYAVLTQKRFAAAQEAGRFQDEIAPVTLKTKKG-ETVVSRDEHNRpETSVESLRKLPKVFKK 243
45656296  159 QTAENLADQYKISRQEQDEWAAISQTRAEKATLEGRLKEEIFTVTIPGKK--PVILEKDEFIKgASGVDKLGSLKAVFRE 236
24213157  159 QTAENLADQYKISRQEQDEWAAISQTRAEKATLEGRLKEEIFTVTIPGKK--PVILEKDEFIKgASGVDKLGSLKAVFRE 236
116332305 159 QTAENLANQYKISRQEQDEWAAISQTRAEKATVEGRLKDEIFAVTIPGKK--PITLEKDEFIKgVSGIDKLGTLKAVFRD 236
116327036 159 QTAENLANQYKISRQEQDEWAAISQTRAEKATVEGRLKDEIFAVTIPGKK--PITLEKDEFIKgVSGIDKLGTLKAVFRD 236
86156492  244 DGVIHAGAASGIADGAGMLVVASRAYAERRGLRPLGRLVNWGHAGVDPTVMGIGPVPAVRNALARAGATLSDLDLFEVNE 323
15614560  237 SGVVTPGNASGINDGAAMMIVSSMDYAERRNLKPLARLVSYAVVGVEPSIMGIGPAPAIQEALRQASMKIEDLDLVEINE 316
51891863  236 GGTVTAGNASGINDGAAMLVLASERRAGAEGWRPLGRLVSWAVAGVDPRYMGMGPVPASRKALERAGLTLEEMDLVEVNE 315
153002943 244 DGVIHAGAASGIADGAGALVVATREYAERRGVKPIARVVNWGHAGVDPTVMGIGPVPAIRNALERAGATLADVDLFEVNE 323
42522018  239 DGIVTAAAASGIVDGAACSLLMSESKAKELGMKPMARIVSYASVGCDPTIMGIGPAGAARLALQKAGLTLDQMDLVEVNE 318
108758110 244 DGVVHAGAASGICDGAGSMVMATGSFVKKHGLQPIGRLVNWGVSGCDPKIMGIGPAPAIRQLLERAQCQLSDIDLFEVNE 323
45656296  237 GGTVTAGNASGLNDGAAVTIVASSSYAKKLGKKPLAIIRGYGHAGCDPAKMGIGPALAIPAALKKAGLKLSDMSLVEVNE 316
24213157  237 GGTVTAGNASGLNDGAAVTIVASSSYAKKLGKKPLAIIRGYGHAGCDPAKMGIGPALAIPAALKKAGLKLSDMSLVEVNE 316
116332305 237 GGTVTAGNSSGLNDGAAATIVTSASYAKKIGKKPLAIIRGYGHAGCDPAKMGIGPALAIPAALKKAGLKLSDMSLVEVNE 316
116327036 237 GGTVTAGNSSGLNDGAAATIVTSASYAKKIGKKPLAIIRGYGHAGCDPAKMGIGPALAIPAALKKAGLKLSDMSLVEVNE 316
86156492  324 AFAPQYLAVEQELGLPRDRTNVDGGAIALGHPLAASGARITMHLLYELRRRGARAGIGSACIGGGQGVAVILEPL 398
15614560  317 AFAAQYLACQQELDFNPDIGNVNGGAIALGHPLGASGARITLSLIYELARRNKKYGVSAVCIGGGQGIAAIWERL 391
51891863  316 AFAAQYLAVEKELELDRERTNVNGGAIALGHPVGASGARLLLTLLLELRRRGGRYGLATLCIGGGQGIAAVVEAF 390
153002943 324 AFAPQYLAVEKELGLPRERTNVDGGAIAVGHPLGASGARITMHLAYELRRRGGRAAVGAACIGGGQGVAIVLAPA 398
42522018  319 AFAAQYLAVEKELKLDPAKTNVNGGAIAVGHPLGASGTRIMNHLVYELHRRNAKYALGSACIGGGQGIAIIIERI 393
108758110 324 AFAPQYLAVEKELGLPRERTNVNGGAIAVGHPLGASGARITTTLVYELKRRGARYGIGSACIGGGQGIAVLVEAL 398
45656296  317 AFAAQYLAVQKELGLNPEITNVNGGAVAIGHPLGASGARVTITLAYELKRRKAKYGIASLCIGGGQGIALVLENP 391
24213157  317 AFAAQYLAVQKELGLNPEITNVNGGAVAIGHPLGASGARVTITLAYELKRRKAKYGIASLCIGGGQGIALVLENP 391
116332305 317 AFAAQYLAVQKELGLNPEITNVNGGAVAIGHPLGASGARVTITLAYELKRRKAKYGVASLCIGGGQGIALVLENP 391
116327036 317 AFAAQYLAVQKELGLNPEITNVNGGAVAIGHPLGASGARVTITLAYELKRRKAKYGVASLCIGGGQGIALVLENP 391
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap