Conserved Protein Domain Family
PRK06840

?
PRK06840: PRK06840 
hypothetical protein; Validated
Statistics
?
PSSM-Id: 235872
View PSSM: PRK06840
Aligned: 23 rows
Threshold Bit Score: 492.598
Threshold Setting Gi: 46198651
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
162447367   1 MKDHVGIVGTGIYLPKERMTAKEISEKTNgvWTEEAVIEKLGIKTKVVPSSSLSdgTQEMGALAALDALKNTGIDPLDID 80 
159900316   4 EFPPIGIAAIATYLPAAVETASQIALAAN--IPEAVVIEKLGIRQKHLAEAHDT--PSAMAAEAARKALAIAELDPLDVD 79 
46198651    1 ----MYLRSLGVYLPKGRMDAQEIARRSG--LPPEVVREKLGLLEKPIPGPEDH--PAEMAAWAAKEALAKAGLPGEAVD 72 
291296054   1 ---MAYLRGLGVYLPTPRMHSSEIAAASG--LPEWVVREKLGIHQKPIPGPEDH--PGRMAGWAARAALEEAGLEGAALD 73 
51891946    4 TQPHVGVVSTGIYIPDRYMTAEEIADRSG--VPLDVVKQKMGILRKPIPGPDDG--TAAMGIRAAQQCIERAGIDPAAID 79 
297566721   1 ---MAYLSGLGVYLPVPRMTSGEIALRSG--LPEWVVREKLGIHQKPVPGPGDD--PAKMAAKAAAEALKDAGVSGAEVD 73 
160901994   8 NGMNVGIMGLGVYIPDNYIYAEEIAKRTN--IPQWVIEEKFGILKKPIPGPEDT--TSYMGIQAAKEAIKDAGIDPKDID 83 
288553810   4 EVEKVGIIATGIYLPEERMTASELAAAAN--LPIGIVQEKLGIVQKTIPGINDH--TCQMGIWAAEKALQKAQINAADID 79 
20807054    4 KNVNVGIVGTGLYIPQTYMTSEDIARETG--IPEEIIRTKFGIIKKPIPGPEDH--TCYMGIQAAKDCLKRTGVDPKEID 79 
157363929   1 MEQHAGIVSVGTYLPQKYMTAEDLSHLAC--IPVDIIVEKFGIRRKYIPRDNET--TSFMGIMAAKEALKNAGISPEEID 76 
162447367  81 IILSVSEEWKEYPLTTSALYVQDRIGAINAWGIDVQNRCCTTVSALKMAKDMLLADPEVNVVMVVGGYRNGDFVDYSDKN 160
159900316  80 LIIYHGSEYKDYVVWSAAAKIQHLIGAKRAYAYEIYALCAGSPVAIKTARDQMRADPMLRNVLLVSAARENELVRYDNQQ 159
46198651   73 WVVSIVEEHKDYPVWATAPYLALKVGASRAKGLDLNQKCASLMGALEVARGLFATRKEVGVVLVAGGYRNGDLVDYQDPH 152
291296054  74 VVISITDEYKDYPVWCSAPLIAQMVGARRAWAFDLNQKCASFISALAVAEGLLASQPDLQHLLIAGGYRNGDLIDYTDPA 153
51891946   80 LVIYIGEEYKEYQLWTAGIKTAHAVGAHNAWAFDAQLRCGTWVLGMKLAQALMLSDDRVNTLLLAGGYRNVDYINYANPR 159
297566721  74 VVLSIVEEYKDYPVWTSAPYIALEVFADRAWGFDINQKCASFITALTVAQGLFAARPEVEVILVAGGYRNGDLIDYTDEN 153
160901994  84 LVIWNGGQHKDYPCWLASLKVAHEIGATRAWGFDMEAMCGSMMVGMETAKSLMMNNDNLNTVLLVSGYRNGDLINYEVPE 163
288553810  80 IIIYIGEEHKEYPLWTAAIKLQESIGAINAWAFDVALRCGTTIMALNLAKSLMKSDDTVRTVLLAGGYRNVDFIDYANPR 159
20807054   80 LIIYIGEEHKEYLLWTSGIKLQYEIGAENAWAFDMALRCGTAVAALKIAKDMMIADDNINTVLIAGGYRNVDFIDYKNPR 159
157363929  77 VVIWNGAQHKDYPCWLASTKVAHEIGAKNAWAFDMEAMCGSMIVGLQVARSLMLSEKNIDTILLVSGYRNVDLVNYQYKH 156
162447367 161 MSMMFNLGAGGGAIILKKNYGKNLLLGSHMISDGSLSRTAGVEIGGIIN-PITKENMDEAKHSLRLLDPVKMKNRLNDVS 239
159900316 160 ARFMFNFGAGASAMLLRRDYATNQVLESAVLVDGSFSENVVMRGGGARF-PTSQATVDAGYHQLDVLQLEDMRDRLGLVS 238
46198651  153 TRFLYDLAAGGAAAVLTREGPGLRLLGLAHRMDPELALSVKVPVGGTRA-PLTPENLS--QYRLRVEDPEGMKRRLDATS 229
291296054 154 VRFMYDLAAGGGAAVMARQGPGFRLLATRLKTDPSLATSVRVPVGGTVE-PLSPMNVD--RYKLRVAEPEVMKARLEQVS 230
51891946  160 VSFMYNLGAGGGAMLLRKNYGRNRVVGSEIIVDGSLSETVGVRGGGT---LAGLHNHDDSLYQLDVFDVEYMKTRLNAVS 236
297566721 154 VRFMYDLAAGGGAAVLTREGPGIKLLSTRLKTDAVLAQSVLVPVGGTAA-PVTPENAG--QFKLRVTNPEWMKTRLEAVS 230
160901994 164 TSFMFDIGAGGAALILRKNLNKNLILSSAFRGDGSFSEQCVIEVGGTKKwPMKPE--DANKFYFTVREFEKFKANLSEKT 241
288553810 160 TRFMYNLAAGGGAIVLKKGAHRHRLLETKLITDGAFSEDVVVPAGGTKQ-PLSPAVLEQKQNYLDVIDPVSMKERLAENS 238
20807054  160 VSFMYDLAAGGGAILLKKNYNRNIVLEASIITDGSFSEDVAVVGGGTKY-PVSHEMIDKGLYKLDVLNPEHMRKGLEEKS 238
157363929 157 TSFMFDIGASGSAVVLKKNSGRNVLLGISSIVDGSFAEDCVVPVGGTKKwPLQPQDLEN--YYFQIKDPENFKNRLNEVT 234
162447367 240 MPNWYKCIDESLRKSNLERKDIDFLNILHIKRSGHLSMLNDLGLTEDQTIYLEDYGHIGQIDQILTLHLALEQGKVKDGT 319
159900316 239 QPNFVQVIDQAVTRSGYRRSDIDFLAITHMKPSFHNGLLHDLGLRPDQAIYLDDYGHIQSVDQQLALDLAQQRGLLKAGD 318
46198651  230 IPSFLAVIREALEEAGYTEADLDYLALLHMKRSAHRAVLAGLGLSEERSIYLERFGHLGQLDPLLSLRLAREKGLLKEGS 309
291296054 231 LTSFLEVIQEALGQAGYTAADLDYLALLHMKPSAHQAVLAGLGLSEERAIYLSDYGHLGQLDPILSLKLAMDAGKLGAGS 310
51891946  237 TQRWVEVVSRVCAQGGYRTQDIDYLAILHMKRSAHQALIEQLGIPVDRAIYLEEYGHIGQIDQILSIHLALERGLIRDGD 316
297566721 231 LPGFFEVIQGSLHDAGYTAADLDYLALLHMKPSAHRAVLEGLGIAEDQCIYLAEYGHLGQLDPILSLKLARDAGKIGPGS 310
160901994 242 MPNFYGVIRDSLKKSGYSEKDIGYLAILHFKRSAHKAVLEELGLKEEQTTYLENYGHLGQNDQVLSMKLALKEGKLNPGD 321
288553810 239 MANFITVIKSSLEKSGYSVGDIDYVAMLHMKKSAHDYILNELGLTQEQSIYLDHYGHLGQIDQILSLELAEKAGMLKSGD 318
20807054  239 MPNFLHVIKESLRKSGYTPSDIGYLAILHMKRSAHEFILNELGLSPDKSIYLENYGHMGQIDQILSTHLALEEGKIKDGD 318
157363929 235 LKNFYFVIDDALRKSNLSRKDISYLAMLHFKRSAHLSVLRELGLRENQTTYLEKYGHMGQNDQVFSIKEGLLSGKIKDGD 314
162447367 320 VMAMIAAGIGYVWAANIIQWG 340
159900316 319 LVVLAGAGTGYTWAASAVRWG 339
46198651  310 LVALAAAGVGYFYGAAVLRLE 330
291296054 311 LVALAAAGVGYHWGAAVLRLE 331
51891946  317 LVVGVSAGVGYAWGATAIEWG 337
297566721 311 LIGLAAAGVGYHWGAAVLRWE 331
160901994 322 VVVMVGAGIGFVWAATTVKWG 342
288553810 319 IVVLVSAGIGYAWGATTIIWD 339
20807054  319 VVVWVSAGIGYVWDAITIKWG 339
157363929 315 VVVLVGAGVGWTWNAAVVRWG 335
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap