Conserved Protein Domain Family
dnaE

?
PRK06826: dnaE 
DNA polymerase III DnaE; Reviewed
Links
?
Statistics
?
PSSM-Id: 235868
View PSSM: PRK06826
Aligned: 50 rows
Threshold Bit Score: 1904.62
Threshold Setting Gi: 51891797
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 51891797    29 PEFVHLHLHTEYSLLDGANRIEPLARRAAELGMRAMAMTDHGVLFGVLPFYKAMRNHGVKPIIGCELYVAPGSRHVKSG- 107
gi 114567554    3 GSFVHLHNHSEYSLLDGACRIKDLVNRAVELEMPAVAITDHGVLYGVIDFYREARKRGIKPLIGCELYVAPRSRLDKEAr 82
gi 258514118    2 PSFVHLHVHTEYSLLDGAARIKEVVKKAKSLGMSALAITDHGVMFGVVDFFKACKKEGIKPILGCEVYVAPRSRHDRTPr 81
gi 222529253    1 MSFVHLHLHTEYSLLDGACRIDRLFERVKDLNMNAVGITDHGAMYGVIDFYKTAKENGIKPIIGCEVYLAPRTRFDKEPn 80
gi 146296832    1 MSFVHLHVHTEYSLLDGAVRIESLFERVRQLNMHSIAITDHGAMYGVVDFYKAAKENGIKPIIGCEVYLAPRSRFDKEPn 80
gi 302871937    1 MSFVHLHLHTEYSLLDGACRIDRLFERVKELNMNAVAITDHGAMYGVIDFYKAAKENGIKPIIGCEVYLAPRTRFDKEPn 80
gi 83590706     2 KSFVHLHVHSEYSLLDGAGRIKDLVRAAGEMGMPALALTDHGVMYGAVEFYKAAREQGIKPIIGCEVYVAPRSRHDREPh 81
gi 297617868    2 QGFVHLHTHSEYSLLDGAVRVSSLVKRAKELGMPALAITDHGVLYGVIDFYKQARKAGIKPIIGCEVYVAPRHRFDRTPk 81
gi 78044608     1 MSFVHLHTHSCYSLLDGAGKIKDLVGRAVELKMPALALTDHGNLFGVIEFYKEAKAQGIKPILGVEVYVAPRTRFDKTPk 80
gi 147678555   13 NLFVHLHLHSEYSLLDGAARINDAVKRASEMQMPALAITDHGVMFGTVDFYKACKKAGIKPVLGCEVYVAPRSMDDRTPk 92
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 51891797   108 -GEKPYHLTVLAENYTGYKNLVKLVSAGYTEGFYYKPRVDLELLNTYREGLIVLSGCLAGEVAQKFLAGQPEEARRAIGR 186
gi 114567554   83 iDDNLYHLTLLCKNELGYRNLVQLVSRAFLEGFYYKPRVDQELLEKYHEGLIALSGCVVGEIPRLLQNGDYRGAREKALY 162
gi 258514118   82 vDDNLYHLVLLAKNETGYRNLLNLVSISFTEGFYYKPRVDKEVLAMYSEGLIALSGCIAGEVAEYILKDLPEQARAAAAE 161
gi 222529253   81 iDNDIHHLVLLAMDNDGYRNLSKIVSIGFVEGFYYKPRVDREVLSKYSKGLIALTSCLAGEIPKLILREQKEKLYDAINF 160
gi 146296832   81 iDNDIHHLVLLAIDNEGYKNLSKIVSIGFVEGFYYKPRVDREILSKYSKGLIALTSCLAGEIPKFILRDQKEKLMDAIGF 160
gi 302871937   81 iDNDIHHLVLLAIDNDGYRNLSKIVSIGFVEGFYYKPRVDREVLSKYSKGLVALTSCLAGEIPKLILREQKEKLYDAISF 160
gi 83590706    82 rDDYQYHLVLLATDATGYRNLTALVSAAFLEGFYYKPRVDRELLSRHSQGLIALSACLAGEVPAHLLKNREDAAYEAATW 161
gi 297617868   82 vDDALYHLTLLCENQDGYRNLVQMVSKAFLEGFYYKPRVDKELLEQHGRGLIALSGCIAGEVPELLLAGNYEEARAVAGY 161
gi 78044608    81 iDDQLTHLVLLAKDRTGYQNLLRLVSRSYTEGYYYKPRVDKQLLAENSQGLIALSSCLAGEIPELILSGQREKAREVAGI 160
gi 147678555   93 iDDNLSHLVLLAENEEGYRNLLNLVSMAFIRGFYYKPRVDKELLSEHSRGLIALSGCIAGEVSARILAGENEKARQAAGD 172
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 51891797   187 YREIFGPDHYFLELQDLGLPEQQGLNRFLL----EQGLPVVATNDAHYLRPQDARTQDVLICIGTNKTIDDPNRMRMGTS 262
gi 114567554  163 YQELFGSGNFYLELQDHGLQEEKASLPGLLrlsrEDSIPLAASNDCHYLRKKDAQVHDVLLCIQTGSVVNDEKRLRFSGS 242
gi 258514118  162 YLKIFGEDNYYLEIQDHSFPEQKKANRELVkiseELNIPLVATNDVHYVAKENAEMQDVLLCIQTGKTVDDPKRMKFQSQ 241
gi 222529253  161 YKEVF-GENFYFELQYHYIDEQRFVNNELMrlskKYQIPLVATNDVHYLRREDRNLHDILLCIQTGKTISDSNRMEFPTD 239
gi 146296832  161 YKDVF-GCNFYFELQYHGIDEQRFVNSELIrlskKYQIPVVATNDVHYLKREDREIHDILLCIQTGKTIHDSNRMEFPTS 239
gi 302871937  161 YKEVF-GENFYFELQYHYIDEQRFVNNELMrlskKYQIPLVATNDVHYLKKEDRNLHDILLCIQTGKTINDSDRMEFPTD 239
gi 83590706   162 LREVFGPENFYLELQDQGLPEQRQLNRRLVdlaaRLKIPLVATNDVHYIRQDQARAHDVLLCIQTGKTLDDPNRLRFPTA 241
gi 297617868  162 FREVFGENNFFLEVQDHGLSEQRVVNEAMChlsrELDVPLVATNDVHYLNRDDAFIHDVLLCIQTGKVLTDESRMRFPCP 241
gi 78044608   161 YRDIFGKENFYLELQYHGISEQKVVNRELIalskQLNIPLVATNDVHYILKEHAKTHDVLLAIQTGKSINDPGRMKFPTE 240
gi 147678555  173 YRDIFGPENFFLELQDHGFAEQRKVNREMLkihkEMNIPLVVTNDVHYVRRGDAETQDVLLAIQTGKSVDDPGRMKFQSE 252
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 51891797   263 ELYVKSAEEMYWRFGHVPGALENSLAIAERCNVELPLGQIHLPHYALPPGY-DAPGYLRKLCYERIGPRYggRPPE--GA 339
gi 114567554  243 EFYMKSREEMAALFPDYPEALENTLKIAGECNLDFTFGEYHLPVFELPPGH-SAESFLSEMVHEKFRRKY--PDAQe-KI 318
gi 258514118  242 EFYLKSPEEMAELFPELPQALQNTVSIADKCEISMEFGQLHLPFYQVPEGH-TVESYLRELCEKGLLDRY--GAAPeeSV 318
gi 222529253  240 EFYLKSPEEMQQLFGYIPEALKNTLEIAEKCNVEFEFGKINLPKFQLPEGKsDAFEYLKELALEGFKKRY--KNDDk-AA 316
gi 146296832  240 EFYLKSAQEMEEVFGYIPESLKNTLEIAEKCNVEFEFGKINLPKFQLPEGKsDAFEYLKELAFAGFEKRY--SKENk-AA 316
gi 302871937  240 EFYLKSSEEMHQLFGYIPEALKNTLEIAEKCNVEFEFGKINLPKFQLPEGKnDSFEYLKELALEGFKKRY--SKNNk-TA 316
gi 83590706   242 QFYLKSPAEMDNLFREVPSALANTLAIAERCHFDFTFGRLHLPAYQVPAGE-DAASYLRRLSYEGLKRRYphDDg---TA 317
gi 297617868  242 EFYFKSGEEMSSLFAHIPEAVTNTVTIAERCSVDFGFDSFCLPEFPLPEGA-TAESYLEDLAWKKLRERF--AHPGt-KV 317
gi 78044608   241 EFYLKTPYEMELIFGELPDALKNTLNIAEQCNLEFEFGRYLLPDFPVPEGK-TPAQYLKELCFQGLYKRY--PNPGe-EV 316
gi 147678555  253 ELYLKSPEEMNLLFGELSGALRNTVEIAGRCNVEIEFGKYYLPHYPVPEGY-DADTYLAELCYQGARRIY--GELSd-GV 328
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 51891797   340 MERLEHELNVIISMGFAGYFLIVWDFVEFARSRGIPVGPGRGSGASSLVAYVLGITDVDPLRYGLLFERFLNPERVDMPD 419
gi 114567554  319 IERLEYELRVINEMGFAAYFLIVQDLVNWSRQNGIPVGPGRGSAAGSLVSYVLDITTIDPLRYDLLFERFLNPERVSMPD 398
gi 258514118  319 RQRMEFELSVIEQMGYSAYFLIVWDFIDYARQNGVPVGPGRGSAAGSLVSYVLGITNLDPLKYDLLFERFLNPERVSMPD 398
gi 222529253  317 YDRLMMELQVIKDMGFVEYFLIVQDFINYAKQNNIMVGPGRGSAAGSIVAYCLGITNVDPIKYDLLFERFLNPERVSMPD 396
gi 146296832  317 YDRLLMELNVIKDMGFTEYFLIVHDFINYAKQNNIMVGPGRGSAAGSIVAYCLGITNVDPIKYNLLFERFLNPERVSMPD 396
gi 302871937  317 YDRLMMELQVIKDMGFVEYFLIVQDFINYAKQNNIMVGPGRGSAAGSVVAYCLGITNVDPIKYDLLFERFLNPERVSMPD 396
gi 83590706   318 RQRLEYELGIIEQMGYPGYFLIVWDMVNFARRRGIPVGPGRGSAAGSLVAYCLGITSIDPLRYNLLFERFLNPERVSMPD 397
gi 297617868  318 IDRLRLELDVINRMGFAGYFLIVQDLVHWAKNRGIRVGPGRGSAAGSLVSYVLGITDINPLEYGLLFERFLNPERITMPD 397
gi 78044608   317 KTRLLHELKIIEQMGFSGYFLIVWDFIRYAREKGIMVGPGRGSAAGSLVAYTLEITDIDPLKYGLLFERFLNPERVSMPD 396
gi 147678555  329 KKRLEYELGVIKQMGYSAYFLIVWDFIHYARQNGIPVGPGRGSAAGSLVAYSLGITSIDPLKYGLLFERFLNPERVSMPD 408
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 51891797   420 FDIDFCYERRGEVIEYVHNKYGAECVAQVITFNTMAARAAVRDVGRALGMSYGEVDRVAKLLP--WGQSLDAALEKTEEL 497
gi 114567554  399 IDIDFCFEKRDRVIDYIISKYGADRVAQIITFGTMAARAAIRDVGRALDVPYGQVDRIAKMVPaeLGVSLERALEISPDL 478
gi 258514118  399 IDIDICYERRNKVIEYVVRKYGAERVAQIATFGTMAAKGAIRDVGRALAMSYGEVDRVAKLVPaeLHMTIEKALSENQDL 478
gi 222529253  397 IDIDFCYQRRQEVIDYVTRKYGEDRVSQIITFGTMAARASIRDVGRVLGVPYSQVDEIAKMIPfsPGMTIDKALEINHDL 476
gi 146296832  397 IDIDFCYQRRQEVIDYVTNKYGKDKVSQIITFGTMAARASIRDVGRVLGVPYAQVDEIAKMVPfsPGMTIDKALEVNHDL 476
gi 302871937  397 IDIDFCYQRRQEVIDYVTRKYGEDRVSQIITFGTMAARASIRDVGRVLGIPYSQVDEIAKMIPfsPGMTIDKALEINHEL 476
gi 83590706   398 IDMDFCFERRDEVIQYVLEKYGRDHVAQIITFGTMAARAAVRDVGRVLGLPLGEVDRIAKMVPmeLGITLERALATSPDL 477
gi 297617868  398 IDIDFCFEKRDQVINYVIEKYGSDRVAQIITFGTMAARAAIRDVGRVLEYPYSEVDRIAKMVPaeLGISLDRALEVSGDL 477
gi 78044608   397 IDVDFCFERRQEVIDYLYQKYGEDRVAQIITFGTMAAKAAVRDVGRALDWPYSEVDKIAKLIPnvLGITLEEAIETTPEL 476
gi 147678555  409 IDVDFCFERRGEIIDYVVRRYGADRVAQIITFGTMAARAAIRDVGRALNMPYGEVDRVAKLVPmeLHMTIEKALNESPEL 488
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 51891797   498 RTLYEEREEIRTLIDTARAVEGMPRNPSVHAAGVVITADPLVEHVPLYKmGDDSIVTQFDMDQLKEIGLLKMDFLGLRTL 577
gi 114567554  479 FTAYQSDYNTRNILDIAQAIEGMPRHASIHAAGVVIGRQSLSEILPLQKtPEGHVLTQFTKETVEDIGLLKMDILGLRTL 558
gi 258514118  479 LEAYNNEPEVRRLIDTAKGLEGMPRHASTHAAGVVITKQPLTHYLPLYKsTDGPVTTQFAKEPVEELGLLKMDLLGLRTL 558
gi 222529253  477 KKIYEQNDTVRRIIDTARNLEGMPRHASVHAAGVVISSCPITDLVPLAR-TDDAIVTQFPMTTLEELGLLKMDFLGLRTL 555
gi 146296832  477 KKIYEQNETVKRIIDTARSIEGMPRHTSVHAAGVVISSCPITDLVPLAR-TEDAIVTQFPMTTLEELGLLKMDFLGLRTL 555
gi 302871937  477 KRIYERNDTVRKIIDTARNLEGMPRHASVHAAGVVISNSPITDLVPLAR-TDDAIVTQFPMTTLEELGLLKMDFLGLRTL 555
gi 83590706   478 KESYEGNREVRELLDTARAIEGMPRHASIHAAGIVITREPLIHYLPLQK-TGDAVTTQYPMQAVEELGLLKMDLLGLRTL 556
gi 297617868  478 AEAYKNDFRVRRLVDTARALEGFPRHASVHAAGVVIGRESLSRVLPLQRtADGHVVTQFTKETVEEIGLLKMDILGLRTL 557
gi 78044608   477 KTLYQNNPKVRELLDLARQIEGMPRHASVHAAGLVIAPEEIDKHIPLFKtSEGVVTTQFEKDTVEELGLLKIDLLGLRTL 556
gi 147678555  489 RELYDQRPEVRKLIDTAAALEGMPRHASTHAAGVVITPEPLTNYLPLYKaTDGPVTTQFAMGTVEELGLLKMDLLGLRTL 568
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 51891797   578 TVIDHAVKFVRQYQpD-FDIERIPMDDPETYAMIARGETLGLFQIEAGWVADVLRQMKPTRFEDIIATISLCRPGPMEH- 655
gi 114567554  559 TVIDRALEIIRKTRdEdIDISSIPLDDEAVYKLLSAGDTAGVFQLESDGLRRLLCEMKPDRFEDIIAVIALYRPGPLGSg 638
gi 258514118  559 TVIADAVAEVNKRAgSpLDIDKITLEDKNTFDLLSRGEGIGVFQLESSGMRAILRDLKPEVFEDIVALVALYRPGPLGSg 638
gi 222529253  556 TVIQNTLELVKKNRgIeIDLDRIDYNDKNVYEFISEGNTNGVFQLESSGMKQFMKELKPENLEDIIAGISLFRPGPMDQ- 634
gi 146296832  556 TVIQNTLELIKKHRkIeIDLDKIDYNDRSVYQFISEGNTNGVFQLESSGMKQFMKELKPENLEDIIAGISLFRPGPMDQ- 634
gi 302871937  556 TVIQNTLELVKKNRgIeIDLDRIDYNDKNVYEFISEGNTNGVFQLESSGMKQFMKELKPENLEDIIAGISLFRPGPMDQ- 634
gi 83590706   557 TVIGHAREAIRRNHgReLDLESLPLDDRPTYQLLASGETSGIFQLESSGMRAILKELKPERFEDIIALVALYRPGPLGSg 636
gi 297617868  558 TVIDRCLDIIRKTRgYeIDIDHISLDDPDTYRLLSEGDTVGVFQLESEGLRRLLQEVRPSSFEDLIAIIALYRPGPLGSg 637
gi 78044608   557 TVIEKALDFIKKQTgKeINLKDIPLDDEKTYKLLGEGDTVGVFQLESQGMRQILKELKPTSIEDLIALVALYRPGPLGSg 636
gi 147678555  569 TVISDALRLIKESTgEeLDIERIPVDDQKTYQMLARGETAGVFQLESSGMRSILRDLRPEVFEDIVALVALYRPGPLGSg 648
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 51891797   656 -IPDYIAGKQNPAGVKYLHPDLEPILSETYGVMVYQEQIIQIAHLLAGLSLGQADLLRRAIAKKKREDMEKYGRLFMEal 734
gi 114567554  639 mVEDFINRKNGRQEIEYIDPLLEDILKETYGVILYQEQVMRVASELADFTMGEADVLRRAMGKKKAEELMAQRDKFiaga 718
gi 258514118  639 mVDDFIKNKHGLQKVSYLHPILEPILKDTYGVILYQEQVMRISSDLAGFSLGEADLLRRAMGKKKPEVIAGLRSQFmega 718
gi 222529253  635 -IPVYIQNKNNREKIEYLHPSLEPILNVTYGCIVYQEQVMQIFRTLAGYSLGRADLVRRAMAKKKADILMEEKDRFIEga 713
gi 146296832  635 -IPVYIQNKNNKEKIEYLHPKLEPILNVTYGCIVYQEQVMQIFRELAGYSLGRADLVRRAMAKKKADILMEERDRFiega 713
gi 302871937  635 -IPVYIQNKNNREKIEYLHPSLEPILNVTYGCIVYQEQVMQIFRTLAGYSLGRADLVRRAMAKKKADILMEEKDRFiega 713
gi 83590706   637 mVEDFIKRKHGVTPISYLHPALEPILKDTYGVILYQEQVMRIASELAGFTLGQADLLRRAMGKKKPEVLAAQRDRFlaga 716
gi 297617868  638 mVEDFVNRKHGRQPIEYLHPKLEPILRETYGVILYQEQVMRIASELADFSMGEADVLRRAMGKKKPDELAAQRNKFvega 717
gi 78044608   637 mVEDFINRRHGRVPVEYPHPDLEPILRETYGVIVYQEQVMLIASVLAGFSLGEADLLRRAMGKKKPEIIAALKNDFIErs 716
gi 147678555  649 mVDDFIKNKHGFKKTKYLHPRLEPILKDTYGVILYQEQVMRIASDLAGFSLGEADLLRRAMGKKKPEIIAGLRSQFiega 728
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 51891797   735 eQRGYSHEVATALYDQMIRFANYGFNKCHATPYAKVAYQTAYLKRHHPVAFMAALMNSVMGQEAKLALYIEECRRLGIQV 814
gi 114567554  719 aRNGIGLATASHLFDLMESFAGYGFNKSHSAAYALISYQTAYLKAHYPVEYLCAFLSSVIDNQDKVVSYIKECRRLGIKV 798
gi 258514118  719 aKKDVDPEVAGKVFDLMEFFAGYGFNKSHSAAYALVSYQTAYLKANYPAEFMAALLTSVRDNSDKVAVYIEECRRMGIVV 798
gi 222529253  714 mANGIDKETAEKIFAIIEDFASYAFNKSHAAAYAILAYQTAYLKKYYTIEFMASLITSVMNSNEKVGMYIEECRKFGISI 793
gi 146296832  714 vANGVDRQTAEKIFEIIEDFASYAFNKSHAAAYAILAYQTAYLKKYFTIEFMTSLITSVMNSNEKVGMYIEECRRFGISI 793
gi 302871937  714 vANGVKKETAERIFAIIEDFASYAFNKSHAAAYAILAYQTAYLKKYYTIEFMTSLITSVMNSNEKVGMYIEECRKFGITI 793
gi 83590706   717 eAKAIPRDVAQKIFELMEYFAGYGFNASHSAAYALVAYQTAYLKAHYPAELMGALLSSVAEHLDKMEPYLAECQRLGIAV 796
gi 297617868  718 yRNGIDRETASSLFELMEHFAGYGFNKSHSAAYALVSYQTAYLKAHYPVEYMCAFLTSVIDNQDRVVYYLKECRRMGMDI 797
gi 78044608   717 vARGYPREKAEEIFNLIEYFAGYGFNKSHSAAYAFVAYYTAWLKANFPVAFLAALLISVKDNLDKVTVYAEDCQRRGIKV 796
gi 147678555  729 aRNGVDGETAGQIFDLMEYFAGYGFNKSHSAAYALVSYQTAYLKANYPLQFMAALLTSVKDNTDKVAAYIEECRRLGIEV 808
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 51891797   815 LPPDVNTSFARFVPDGRTIRFGLGAVKNIGWNAVDAIVAAREEGGPFTSLRDLCERVDLRPLNRRALESLIMAGAFDRVA 894
gi 114567554  799 LPPDINESYENFSVARDAIRFGLGAIKNVGQNAVKNIVEARKQ-GFYTSLFDFCRRVDLGQLNKRMLENLILAGCFDSLG 877
gi 258514118  799 LPPDVNESRDGFTVVGDKIRFGLAAMKNVGLAAVYSIISMREQGGPFKNYADFCNRLDTRVVNRRVLESLIKGGAFDSLG 878
gi 222529253  794 LPPDINKSSYDFTIEGNSIRFGLRAIKSLGENVIAHILKEREKKGEFKDLYDFIMRVDTNTVNKRIIENLIRSGAFDFTG 873
gi 146296832  794 LPPDINKSSYDFTIEGNSIRFGLRAIKSLGENVISHILKEREQNGEFKDLYDFVMRVDTNTVNKRIIENLIKSGAFDFTK 873
gi 302871937  794 LPPDINKSSYDFTIEGNSIRFGLRAIKSLGENVIAHILKEREEKGEFKDLYDFIMRVDTNTVNKRIIENLIRSGAFDFTR 873
gi 83590706   797 LPPDVNESGVDFTVTGRQIRFGLAAVKNAGRAAALAIIAAREAGGPFTSLLDFCRRVDSRQANKRVVESLIRCGAFNSIN 876
gi 297617868  798 LPPDINESFENFTVAGGRIRFGLGAIKNVGINAVRSIIEARKE-GRFSSLLEFCLRVDLRQLNKRVMENLILAGAFDSLG 876
gi 78044608   797 LPPDINLSEVDFTISGQEIRFGLAAVKNVGEAAAAKIIEERQK-GPFRDFNDFLHRIDKKTVNKRVIESLIKAGAFASFG 875
gi 147678555  809 LPPDVNESRESFTVAGNKIRFGLAAVKNVGMGAVDSIIRAREKDGPFSDYADFCRRLDTRVVNKRVLESLIKCGAFDSLG 888
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 51891797   895 ppggrpARRSQMLEALDKILDDAQKLQRHRQAGQISLFDLGVAgpgtagEEP----------LPDIPEFPPQRLLAMEKE 964
gi 114567554  878 ------FSRKGALSIMEECVNISLAIKQNECSQQGSLFGDememv-------------eepiIKLKGEYESRERLLKEKE 938
gi 258514118  879 ------HRRAQLMAVVDTGLSIAQQAQRDRNSGQMSLFEFLEE------EEEynl----sfvLPDIAEYLYSEMLALEKE 942
gi 222529253  874 ------LNRNSLLASVEDIL--AIKQTKKKNANQFSFFEI---------SGNene----sfvYKNMPQPTAQELMKMEKD 932
gi 146296832  874 ------INRNSLLASVEDIL--TIKQSQKKNANQITFFEI---------SDDqtk----ifsYKDLPEPTTEELLQMEKD 932
gi 302871937  874 ------INRNSLLASVEDIL--VLKQAKKKNANQFSFFEI---------SGNene----sfeYKSLPQPTAQELMKMEKD 932
gi 83590706   877 ------PNRRQLLAGLDECLEVAARRQEDRRSGQVSLMDLVPEe----vNDPp---------LPQVTDFSRADILAMEKE 937
gi 297617868  877 ------LKRKEALSLLDECLALAVEVRAAMDSAQPSLF-----------VDDaaatvvqdpvPRSKGEFSVQEKLKKEKE 939
gi 78044608   876 ------FNRKTLLNNLDDALEFYSKKSNGV---QLTLGDFLPE------ADRynl--------rleEEFSKLELLRMEKE 932
gi 147678555  889 ------YRRAQLMAAVDSGLALAQQSQRERENGQLSLLDFFGG------STDsvs-----isFPEVGEYPEDELLAMEKE 951
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 51891797   965 VLGFYVSGHPLRQYQAALAAHGCLPVAALPE-----QRDGARVAVGGMVAGLKQVTTRSGANMAFLTLEDQTGQVEVVVF 1039
gi 114567554  939 VLGFFVSESPLDEFRSLLPLISTHCLEDINL-----WEEESYVRVAGIVVNLSRRVSRKGESYARFVLEDLGGRIEVLVF 1013
gi 258514118  943 SLGLYISGHPLAEYREVLRQNDTVNAGELPD-----FTEGETVALGGLIINYKQITTKKGDAMAFVNLEDLTGVVEVVIF 1017
gi 222529253  933 TIGVYISSHPLEKYTEEISKYNITPLSEIsamseedeyKFEQILVCGILKEVKVKLTKNNLTMAFAKLEDLTDSVEVLFF 1012
gi 146296832  933 TIGIYISGHPLEKYGDLISKYNVVSLAELsnmteddeyKYQQILVCGILKEVKIKLTKNNQTMAFAKIEDLTDTLEVLFF 1012
gi 302871937  933 TIGIYISSHPLERYTEEISRYNVTPLSEIstmseedeyKFEQILVCGILKEVKVKLTKSNQTMAFAKLEDLTDSVEILFF 1012
gi 83590706   938 LLGFYLSGHPLEPYAPVLKKLTSHSLADLAE-----IADGSQVTIGGLVSGLRRLVTRKGDPMAVLTLEDFSGQVEAVLF 1012
gi 297617868  940 VLGFYVSQNPLEEYREVIPYLMSHEISELSK-----LDEGQVVRIVATVTAMKRSRSKKGEPWARLVLEDFTGKVEAVVF 1014
gi 78044608   933 SLGLYLTGHPLAGLRSFIQKHCNLK------------ENKEKIYYPAILAEIKRTVTRRGEPMAFALLEGLNQTVEAVIF 1000
gi 147678555  952 TLGLYISGHPLSRYREALNRLTTVKTVEITD-----LPDNSEVVLGGLITDVKKINTRRGEVMAFLTLEDLTGTVEVVVF 1026
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 51891797  1040 PRVLQACARVLREEQPLLVRGRLQVQEDE-VKLLADEVSLLRddekprrpepperievgaaqprglepgpgrmsgdmgsd 1118
gi 114567554 1014 PSAYRKNGDRLEADRAVIVEGYFD-RREEqPKIALRKTGPIP-------------------------------------- 1054
gi 258514118 1018 PRIFKQYRQLLQPDRVVLVKGRVN-QAGEeIKIIAEEVSSLVk------------------------------------- 1059
gi 222529253 1013 PNVYEKYSHLIKEDMVVIMEAKATFREDEgVKVIAQKVDRLGekhqegq------------------------------- 1061
gi 146296832 1013 PSVYEKYSHLIKENTIALIEAKATFREDEgVKIVAQKIDRLGekvqt--------------------------------- 1059
gi 302871937 1013 PSVYEKYSHLIKEDMIVLIEAKATFREDEgVKVIAKKVDRLGsdrpe--------------------------------- 1059
gi 83590706  1013 PRMYSQVRSWLAPDRAVLVQGQVD-KQEEgVQVLANLVRPLAp------------------------------------- 1054
gi 297617868 1015 PAVYRQHYRQIKLDTALVIEGKV-IHRDDsVEVAVNQVYPVS-------------------------------------- 1055
gi 78044608  1001 PDCWLTYRDLLQEENILWFYGAVE-EDEEgLKMIVERVYELDm------------------------------------- 1042
gi 147678555 1027 PRTYTQNRLALRVDEVVLVKGKTS-GGGEeTKIIGEEISTVEs------------------------------------- 1068
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 51891797  1119 phatvrgpgaapepaaargKQaapasarqpgpppasepapgparATAaeaaretplgpqpqfVYLRVPARDENSPMMRRV 1198
gi 114567554 1055 -------------------ES-----------------------LRE---------------MHLRLAGNGDGEMDRNKL 1077
gi 258514118 1060 -------------------TT-----------------------QGD---------------LYLQFIKR-DMQT-VKQV 1080
gi 222529253 1062 --------------------------------------------------------gsgekaIAIRVSDDTILKS--KKF 1083
gi 146296832 1060 --------------lssqrNS-----------------------NKA---------------IAIKTDEDSILKS--KKF 1085
gi 302871937 1060 ---------------etqnSR-----------------------EKA---------------IAIRVSDDTILKS--KKF 1084
gi 83590706  1055 -------------------EAgggdrtlpppagthgtlpearqgGGR---------------LYLKLSSEGQLTA----L 1096
gi 297617868 1056 -------------------HE-----------------------LKE---------------LHIQVSNAAGTGNSKSEL 1078
gi 78044608  1043 -------------------SN-----------------------ALE---------------VYLKV----SPGN-IPLV 1060
gi 147678555 1069 -------------------CL-----------------------GGE---------------LHIKIDSV-SSPL-LDQI 1089
                        1210      1220      1230      1240      1250
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 51891797  1199 EQVLRAHPGPTRVRIKMEPEGKWIEVHEHLRVTVTPSLVNALARIVGE-QSVVVR 1252
gi 114567554 1078 VKLLQKYPGDIEVFLH-LPGRRLLVLNEKFNVSPSQDLKQELAAVYGP-QNVWFN 1130
gi 258514118 1081 QLILQTYPGNNHVYLYFPQEKKLAKTSENYWVNLDSEVVKELEQVLGV-SNVRIK 1134
gi 222529253 1084 LAFIKFFSGKSKIVLY--YNQKRLISKSNLCIEINPTVIEQLKEWFGD-ENVWIE 1135
gi 146296832 1086 TSFVRFFTGSSKIILY--YKQKRLVSKSNMGIDINPTVIQQLKEWFGE-ENVWLE 1137
gi 302871937 1085 LAFLKFFAGKSKIVLY--YNQKRLISKSSLCIEINPTVIEQLKEWFGE-ENVWIE 1136
gi 83590706  1097 RDTLAAHPGPCQVYLYLADSRRTIALHRRYWIEPVPELMASLAGLLGGyDKIKLV 1151
gi 297617868 1079 VRILGGYSGEIPVYLR-LSANKVIRLDKNLWVQPSLALKQQLSSLYGR-GNVWFR 1131
gi 78044608  1061 QGILRKYPGPAPVYLY-PGGKKLIKLSQEYWIDLKSPVLWEIKKLLGD-ENVKTK 1113
gi 147678555 1090 QLILSSFKGESPVFLHFEKERRIIKAGENFWVDLSGPVVSRLEDLLGH-ARVKIK 1143
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap