Conserved Protein Domain Family
PRK06816

?
PRK06816: PRK06816 
3-oxoacyl-(acyl carrier protein) synthase III; Reviewed
Links
?
Statistics
?
PSSM-Id: 235866
View PSSM: PRK06816
Aligned: 32 rows
Threshold Bit Score: 522.162
Threshold Setting Gi: 163859176
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
297569112   1 MNVFITDLATFLPGPPISNQQLDDYLLGADRISTKTRKIILQNNGISTRHYALEPGtGRLTHSNRELTAEAVRALCAQGR 80 
239815332   6 QRVYIESAGYFMPGEPIPNERMDAYIAPLNRMSERIKRRILAENGILTRHYAIDEE-GMTRHTNAQLAACAIRDCLQRGG 84 
170728369   1 MNVYINSTGHYLPGPPIDNDEIEDILGLVNGKKSRLKHKILQSNGIKTRHYAINQQ-QETQISNSEMAAHAGIKCLDASY 79 
302384129   7 RDVYITGTGAFLPGDPVGVDTMEDFIGRIGGRSSAVGRRALRWNGVETRHYALTPE-GRPLHSNASMTAAATRAALDDAG 85 
256421213   2 HKVFITATGKFLPNTAIPNEAMEDYLGRINGQSSRTKDIFLRKNGIKSRYYALDTQ-QQTTHQAYEMASKAIDDCLEGAA 80 
160897136   6 SNVYLHAAGMFLPGEPVDNAGMDAYVAPLNRLSERLKRRILAENGIVQRHYAIDAE-GRTVHSNTAMAAQAIHDCLAQAG 84 
163859176   6 DRVYLESAGYFMPGEPVANQDMDRYIAPLNRMSGRIKQRILAENGIKQRYYAIDAA-GNTRWTNAAQAAQAIRNCLDRQQ 84 
16125118   25 DQAYITGVGAFLPGEPVPSAAMEDFIGRIGGRGSLMGRRALRWNGVETRHYALSPG-GRPNHSNAGMCALAVRRALDDAG 103
158335986   5 QAVFITGVGKFLPGEPVANQDMAAYIGSISKRSSTLGSAILRKNGIKHRFYALDTE-GGYRYTNASMAAHAIHDALKQAR 83 
221233845  25 DQAYITGVGAFLPGEPVPSAAMEDFIGRIGGRGSLMGRRALRWNGVETRHYALSPG-GRPNHSNAGMCALAVRRALDDAG 103
297569112  81 CRLDQIACLSCGTASPDQLMPGHASMVHGELGAAPCEINTANGICLSGIMAMKYGAMAVALGLAENAVATGSDLSSSFLR 160
239815332  85 AELSRVSLLASGSSGGDTLMPGFANMIQGELAAPPMETLSVHGICAAGVSAIQSAAQGIELGAHRSALAVASEMPSRLFK 164
170728369  80 ISPHQIEMLSVATSQGDLVLPGFGSMVQAELDIPSVELQTSHGICSSSMMALKSAYTNIKAQESANALVIASELASRLFK 159
302384129  86 LSVGRLGHLATATTQGDYIVPGHASAVHAELGAGPIEIASYQSVCASALMAAKGAWLQVRAGEAEVAAAAAGEFSSRWFR 165
256421213  81 AGKQNIDFLSTATTQSDLPVPGFASMVQGESGIGTCTLASHQSVCAASIMAIQNAYMHVQAGQSRNAVSCAAELPSRMFK 160
160897136  85 RALGDVGFLASGSSGGDALMPGFANMIQGEMAAPPMETLSVHGVCAASVGALQAAAQAVDRAPDSLALAVASEMPSRLFK 164
163859176  85 RGLADVSLLASGSSGGDTLMPGFANMIQGELAAPPMELVSVHGICAAGVAAVQAAAQGIELGAHRRALAVASEMPSRLFK 164
16125118  104 LGPEDLGFLAAATTQGDFLVPGHAAMVHGELGCGPIEIASFQSVCASSLMAAKSAYLSVRTGEHRVAAACAGEFSSRWFQ 183
158335986  84 CQPEQVDLLATSTTQGDYLVPGFASAVHGELGIPPLAIFSFQSVCASSLMAVKNAWLNVKVGESQLAVASGSEFASRWFR 163
221233845 104 LGPEDLGFLAAATTQGDFLVPGHAAMVHGELGCGPIEIASFQSVCASSLMAAKSAYLSVRTGEHRVAAACAGEFSSRWFQ 183
297569112 161 PSFLKPppnpeaATGTPRHPAFSFEADFLRWMLSDGAGAMLL----EKQPA-GDGISLRIDWLEIVSQAHHRETCMYAGG 235
239815332 165 RSRFAA-----------RGYETDFDSHFLRWMLSDGAGALLLsdgaPALAG-NPGLRLRLKWVHQRAFSGDYPVCMQLGL 232
170728369 160 HTRYEQ----------VEGNEIDFNAEFLRWMLSDGAGALLL----ENQPR-KTGKSLRIDWIKSFSHADVYPVCMSVGM 224
302384129 166 PEFYEG------TALVDAKGRARVEADFLRFTLSDGAGSVIM----EPKPR-PDGLSLKVDWIDLTSLAGRFDPCMWAGS 234
256421213 161 ASRFAG------QSIVGTDAALPADIDFLRWMLSDGAGAMLL----QPVPS-RTGVSLEIEWIDLRSYAHQYDLCMYTGT 229
160897136 165 RSRFAA-----------QGYNTDFDAHFLRWMLSDGAGAVLLgg-pQALPQ-APGLRLKLRWTHLRSFAGDYPVCMQLGL 231
163859176 165 RSRFAA-----------RGYDADFDAHFLRWMLSDGAGAVLLgssgASLPGvSAGVRLRLKWVHQRAFSGDYPVCMQLGL 233
16125118  184 PSFYEG------SSLLDDKQRLKPQADYLRFTLSDGAGAVLV----EPAPR-PQGLSLRIRFIDMVSLAGQFDPCMWAGA 252
158335986 164 PSVYRP--------FYDEAARPDPQIEFLRWTLSDGAGALVL----EPGPK-PDGVSLRVDWIQFKSFADRFPPCMYAGA 230
221233845 184 PSFYEG------SSLLDDKQRLKPQADYLRFTLSDGAGAVLV----EPAPR-PQGLSLRIRFIDMVSLAGQFDPCMWAGA 252
297569112 236 VKEEDGS-IRGWRQYDHiEEALAQGSFAVKQDARLLNRAVIQAliEESLPPLLAKHDLQPEQVDWFLPHYSSEYFRMPLH 314
239815332 233 TEDR----ARGHLDFGSwAEAEAAGALSLRQDIRLLPHLFDIG--IHEYATLVQGGWLDPKRIDHFLCHYSSEKFIPVVE 306
170728369 225 PKNA----TKSWQDFPTySEAEQAGALLLRQDVRLLDNIVSVG--VNGFLKLLQDGMFKVPEIDHVLCHFSSAYFKSKIV 298
302384129 235 TFADRADmKSAWSHAGP-VAAHASGSVALVQDFELLKIVIRAW--IGVWLEKVDQGRIVPDEVDHLLCHYSARSLREEIV 311
256421213 230 NKQADGSiSKTWLDYESmSAADKDGAINLKQDMQLVDNIVKLG--IQRFFELVDEKKIAPEAIDWLVCHYSSHHFKKQIT 307
160897136 232 TPDR----ATSHLDFAAwGDAEAAGALSLRQDIRLLPHLFDVC--IHEYAHLAHTGWVPERGIDHFLCHYSSERFIPVVD 305
163859176 234 PAEG----GQGHLDYPSwAEAEAAGALALRQDIRLLPNLFDIG--IHEYASLVRDGWVDPDRVDHFLCHYSSEKFIPVVE 307
16125118  253 GLESHAEaLDGWSHLGP-QAAHRAGGLALLQDFDLLKRVIRAW--VGVYLKKVDEGRIVPDEIDHLLCHYSARSLREEIV 329
158335986 231 KSNTGAD-DQGWGLYESpQAAYEAGAIALKQDFEILYAMFPVW--VGYYLELLEKYDLDPNAIDYFLPHYSSHSLGEEMK 307
221233845 253 GLESHAEaLDGWSHLGP-QAAHRAGGLALLQDFDLLKRVIRAW--VGVYLKKVDEGRIVPDEIDHLLCHYSARSLREEIV 329
297569112 315 DQLAAIDFPIPYEKWFTNLKTKGNTGAASFYIMLAELFASGR--LQRGEKIFCFIPESGRFAVGYILLTVV 383
239815332 307 DLMAKADLAIPRERWWSNLAWRGNTGAASILIMLSEFLHTKA--LKPGEQIFCYVPESGRFMAAYMLLEVE 375
170728369 299 EMLEVAGVQIPEKKWYTNLYERGNTGCASIFIMLDEFLATQD--LSVGETLFCMVPESGRFNCAYMHLTVV 367
302384129 312 SVLKSTAAMIPEEKWFSNLPTVGNIGAASIWVMLDEFMKSGR--AKRGEKVLLIVPESGRAMVGFMMCEVV 380
256421213 308 DLLEKGGADIPAEKWFTNLYTVGNIGSASIFVMLDELLHSGK--LKHGQQVLCMVPESGRFITGYMMLRVV 376
160897136 306 ELLGKAQLGIPRERWWSNLAWRGNTGAASIFVMLSEFLRTQSarLKHGDTVLCFIPESGRFTAGYMLLEVE 376
163859176 308 GLMDKAGLSIPRERWFSNLAWRGNTGAASILIMLAEFLETHA--LQPGQQVFCYVPESGRFTTAYLLFEAE 376
16125118  330 SLLEKTNGMIPEEKWFSNLATVGNVGSASIWVMLEAFLRSDR--LKPGQTVLCVVPESGRSMVGFMLLEAV 398
158335986 308 RLLRRTGAMIVEERWCNNLERYGNTGTASIFIMLEELVQKHP--LQPGQRILCFVPESGRCIAAFMHLTVV 376
221233845 330 SLLEKTNGMIPEEKWFSNLATVGNVGSASIWVMLEAFLRSDR--LKPGQTVLCVVPESGRSMVGFMLLEAV 398
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap