Conserved Protein Domain Family
flgD

?
PRK06792: flgD 
flagellar basal body rod modification protein; Validated
Statistics
?
PSSM-Id: 180695
View PSSM: PRK06792
Aligned: 20 rows
Threshold Bit Score: 247.62
Threshold Setting Gi: 152975164
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30261750    1 MPTVGLNTTSTNHIPLQAGAQTKNASVTGAQSTAQQANGVSASTQKTPGIMDKDDFLKLFLASFQHQDPFNAMDMNQMMN 80 
42780845    1 MPTVGLNTTSTNHIPLQAGAQNRNAPVNGAQPAVGQMNGVSAGEQKTPGVMGKDDFLKLFLSSFQHQDPFNAMDMNQMMN 80 
30019796    1 MPTVGLNTTSTNHIPLQAGAQTKNASVNGVQSPVQQTNGVSASNQKTPGIMDKDDFLKLFLASFQHQDPFNAMDMNQMMN 80 
163939558   1 MPTVGLNTRSTNHIPLQAGAQKSNAPVNGVQSPVQQTNGVSESAQKTPGVMGKDDFLKLFLSSFQHQDPFNAMDMNQMMN 80 
218235843   1 MPTVGLNTTSTNHIPLQAGAQKSNVPVNGVQSPVQQSNGVSAGAQKTPGVMGKDDFLKLFLSSFQHQDPFNAMDMNQMMN 80 
217959236   1 MPTVGLNTTSTNHIPLQAGAQNRNASVNGAQPAVGQMNGVSAGEQKTPGVMGKDDFLKLFLSSFQHQDPFNAMDMNQMMN 80 
218896685   1 MPTVGLNTTSTNHIPLQTGAQKSNVPVNGVQSPVQQSNGVSAGAQKTPGVMGKDDFLKLFLSSFQHQDPFNAMDMNQMMN 80 
222095376   1 MPTVGLNTTSTNHIPLQAGAQNRNASVNGAQPAVGQMNGVSAGEQKTPGVMGKDDFLKLFLASFQHQDPFNAMDMNQMMN 80 
227815487   1 MPTVGLNTTSTNHIPLQAGAQTKNASVTGAQSTAQQANGVSASTQKTPGIMDKDDFLKLFLASFQHQDPFNAMDMNQMMN 80 
301053290   1 MPTVGLNTTSTNHIPLQAGAQTKNASVTGAQSTAQQANGVSASTQKTPGIMDKDDFLKLFLASFQHQDPFNAMDMNQMMN 80 
30261750   81 QTAQLSLMEQVQNMTKAVDKLQSTMYSTALDGGMKFLGKYVRGVSNNGKQVTGQVETVRLAENNDVQLIVDNQVVSLRFI 160
42780845   81 QTAQLSLMEQVQNMTKAVDSLRTTMYSTALDGGMKFLGKYVRGIDGDGKKVTGQVETVRLAENNDVQLVIDNKIVSLRFV 160
30019796   81 QTAQLSLMEQVQNMTKAVDKLQSTMYTTALDGGMKFLGKYVRGINNKGEQVTGQVETVRLAENNDVQLIVDNQVVSLRFV 160
163939558  81 QTAQLSLMEQVQNMTKAVDSLRTTMYSTALDGGMKFLGKYVRGIDGDGKKVTGQVETVRLAENNDVQLVIDNKIVSLRFV 160
218235843  81 QTAQLSLMEQVQNMTKAVDKLQSTMYSTALDGGMKFLGKYVRGVDGEGNKVTGQVETVRLAENNDVQLVINNKVVSLRFV 160
217959236  81 QTAQLSLMEQVQNMTKAVDSLRTTMYSTALDGGMKFLGKYVRGVDGDGKKVTGQVETVRLAENNEVQLVIDNKVVSLRFV 160
218896685  81 QTAQLSLMEQVQNMTKAVDKLQSTMYSTALDGGMKFLGKYVRGVDGDGNKVTGQVETVRLAENNDVQLVINNKVVSLRFV 160
222095376  81 QTAQLSLMEQVQNMTKAVDKLQSTMYSTALDGGMKFLGKYVRGVDGDGKKVTGQVETVRLAENNEVQLVIDNKVVSLRFV 160
227815487  81 QTAQLSLMEQVQNMTKAVDKLQSTMYSTALDGGMKFLGKYVRGVSNNGKQVTGQVETVRLAENNDVQLIVDNQVVSLRFI 160
301053290  81 QTAQLSLMEQVQNMTKAVDKLQSTMYSTALDGGMKFLGKYVRGVSNNGKQVTGQVETVRLAENNDVQLIVDNQVVSLRFI 160
30261750  161 ERVSDKPITETNPEDEKKDDIEKNEEVKPD 190
42780845  161 ERVSDKPIGETNPEDAKKDDQKVAEEEKTT 190
30019796  161 ERVSDKPIAETNPEDEKKDDIEKNEEVKQN 190
163939558 161 ERVSDKPIGETNPEDAKKDDQKVTEEVKTT 190
218235843 161 ERVSDKPIGETNPEDAKKDDQKVTEEVKTT 190
217959236 161 ERVSDKPIGETNPEDAKKDDQKVTEEEKTT 190
218896685 161 ERVSDKPIGETNPEDAKKDDQKVTEEVKTT 190
222095376 161 ERVSDKPIGDTNPEDTKKDEQKVTEEEKTT 190
227815487 161 ERVSDKPITETNPEDEKKDDIEKMKRLSQI 190
301053290 161 ERVSDKPITETNPEDEKKDDIEKNEEVKPD 190
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap