Conserved Protein Domain Family
PRK06759

?
PRK06759: PRK06759 
RNA polymerase factor sigma-70; Validated
Statistics
?
PSSM-Id: 235857
View PSSM: PRK06759
Aligned: 20 rows
Threshold Bit Score: 216.223
Threshold Setting Gi: 212639788
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 152977451  11 TLYEKMIKNQMKRLCLYKDYEEFYQCGLIGLWMAYERYEEEKGSFSNYAFVTVRGYLLEKLKKEnrFQTYHTCFEQEHFE 90
gi 42784415   11 LLYEGLIVNQIKRLGIYQDYEEYYQCGLIGLWHAYEKFDAEKGSFPAYAVVTVRVYILERLKKE--FAVQEKCVCVGAYE 88
gi 30023283   11 VLYEGMIVNQIKKLGIRKDYEEYYQCGLIGLWHAYERFDEKKGYFPAYAVVTVRGYILERLKKE--FAVQERCVCVGEYE 88
gi 163942935  11 VLYEGMIVNQIKRLNIYQDYEEYYQCGLIGLWHAYERYEEEKGSFPAYAVVTVRGYILERLKKE--CVVQERYVCTDEYK 88
gi 217962737  11 VLYEGMIVNQIKKLGIYQDYEEYYQCGLIGLWHAYEKFDAEKGSFPAYAVVTVRGYILERLKKE--FTVQEKCVCVGEYE 88
gi 218233984  11 VLYEGMIVNQIKKLGIRKDYEEYYQCGLIGLWHAYERFDEKKGYFPAYAVVTVRGYILERLKKE--FAVQERCVCVGEYE 88
gi 218900375  11 VLYEGMIVNQIKKLGIRQDYEEYYQCGLIGLWHAYERFDAKKGYFPAYALVTVRGYILERLKKE--STVQERCVCVGEYE 88
gi 222098712  11 VLYEGMIVNQIKKLGIYQDYEEYYQCGLIGLWHAYEKFDAEKGSFPAYAVVTVRGYILERLKKE--FTVQEKCVCVGEYE 88
gi 225867222  11 VLYEGLIVNQIKKLGIYQDYEEYYQCGLIGLWHAYERYDAKKGSFPAYAVITVRGYILERLKKE--FAVQEKCVCVGEYE 88
gi 296505675  11 VLYEGMIVNQIKKLGIRKDYEEYYQCGLIGLWHAYERFDAKKGYFPAYAVVTVRGYILERLKKE--FAVQERCVCVGEYE 88
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 152977451  91 HVCGVVEVSSEVHEYMSVLNEREKHVITESFFMGKSIDEIAGEMGLTYYQVRWIYRQAFKKMRTGA 156
gi 42784415   89 DIFHFEDIKMKAKDFMSVLDEKEKYIIFERFFVGKTMGEIALETEMSYYQVRWMYRQALEKMRNSL 154
gi 30023283   89 DIFHFEDVEIRVKDFMSVLDEKEKYIIFERFFVGKTMGEIALETEMTYYQVRWMYRQALEKMRDSV 154
gi 163942935  89 ERFECEDAGTRAKDFMSVLDERERHIISERFFSGKNMGEIASEMGMTYYQVRWVYRQALEKMRDSV 154
gi 217962737  89 DIFRFEDIEMKVKDFMSVLDEKEKYIIFERFFVGKTMGEIALETEMTYYQVRWIYRQALEKMRNSL 154
gi 218233984  89 DIFHFEDVEIRVKDFMSVLDEKEKYIIFERFFAGKTMGEIALETEMTYYQVRWMYRQALEKMRDSV 154
gi 218900375  89 DIFHFEDVEIRVKDFMSVLDEKEKYIIFERFFVGKTMGEIALETEMTYYQVRWMYRQALEKMRDSV 154
gi 222098712  89 DIFRFEDIEMKVKDFMSVLDEKEKYIIFERFFVGKTMGEIALETEMTYYQVRWIYR---------- 144
gi 225867222  89 AHFHFEDIEMKVKDFMSVLDEKEKYIIFERFFVGKTMGEIALETEMTYYQVRWIYRQALEKMRNSL 154
gi 296505675  89 DIFHFEDVEIRVKDFMSVLDEKEKYIIFERFFVGKTMGEIALETEMTYYQVRWMYRQALEKMRDSV 154
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap