Conserved Protein Domain Family
PRK06690

?
PRK06690: PRK06690 
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 180659
View PSSM: PRK06690
Aligned: 25 rows
Threshold Bit Score: 588.658
Threshold Setting Gi: 157693138
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
305673738   1 MNAVIVGAKRTIFGKQNGLLKPFLPEDLAAPIISCLSRNLEDQIDEVILGNATGRGGNLARLSALQAGLPLSVPGMTIDR 80 
154685487   1 MEAVITDAKRTIFARENGLLKDCLPEDLAAPLIRHLSRNMPEDIDEVLIGNATGRGGNLARLSALAAGLPLSVSGTTIDR 80 
30021725    2 NRAVIVEAKRTPIGKKNGMLKEYEVQQLTTPLLTFLSKGIEREIDDVILGNVVGPGGNVARLSALEAGLGYHIPGVTIDR 81 
218898718   2 NRAVIVEAKRTPIGKKNGMLKEYEVQQLVTPLLTFLSKGIEREIDDVMLGNIVGPGGNIARLSALEAGLGYHIPGVTIDR 81 
218236003   2 NRAVIVEAKRTPIGKKNGMLKEYEVQQLTTPLLTFLSKGIEREIDDVILGNVVGPGGNVARLSALEAGLGYHIPGVTIDR 81 
294499253   4 YQAAVVKAKRTVIGKENGALKNFRVQELAAPLLKQLSAGIEHEIDDIILGNVVGPGGNVARLSALEAELPFSIPGMTIDR 83 
295704605   4 YQAAIVKAKRTVIGKENGLLKDFHVQELTAPLLKHLSAGIEHEIDDIILGNVVGPGGNAARLSALEADLPFSIPGMTIDR 83 
296504130   1 ------------------MLKEYEVQQLTTPLLTFLSKGIEREIDDVILGNVVGPGGNVARLSALEAGLGYHIPGVTIDR 62 
163941232   2 NRAVIVEAKRTPIGKKNGMLKDYEVQQLVTPLLTFLSKGIEREIDDVILGNIVGPGGNVARLSALAAGLGYHIPGVTIDR 81 
16078099    1 MNAVIVDAKRTIFGNQNGLLKPFLPEDLAAPIIRCLSRKLEDQVDEVILGNATGRGGNLARLSALQAGLPLSVPGMTIDR 80 
305673738  81 QCGSGLEAVRYACSLIQAGAGTMYIAGGSESSSRSPFSERARFSPDVIGDPDMGIAAEYTAANYSISRSMQDEYALLSYQ 160
154685487  81 QCGSGLDAVRVACHFVKAGAGRTYIAGGAESSSRSPFSSRARFSPEHIGDPDMGIAAEYTAQAYGVTRKMQDEYALLSYE 160
30021725   82 QCGAGLEAIRTACYLIQGGAGKCYIAGGVESTSTSPFQKRARFSPETIGDPDMGVAAEYVAERYNITREMQDEYACLSYK 161
218898718  82 QCGAGLEAIRTACHLIQGGAGKCYIAGGVESTSTSPFQKRARFSPETIGDPDMGVAAEYVAERYNITREMQDEYACLSYK 161
218236003  82 QCGAGLEAIRTACHLIQGGAGKCYITGGVESTSTSPFQKRARFSPETIGDPDMGVAAEYVAERYNITREMQDEYACLSYK 161
294499253  84 QCGAGLEAIRMASYLIKAGAGTCYLAGGVESTSTSPFEKRARFSPDKIGDPDMGIAAENVAQQYNISKDQQDRYALLSHE 163
295704605  84 QCGAGLEAIRMASYLIKAGAGTCYLAGGVESTSTSPFEKRARFSPDKIGDPDMGIAAENVAKRYNISKDQQDRYALLSHE 163
296504130  63 QCGAGLEAIRTACHLIQGGAGKCYIAGGVESTSTSPFQKRARFSPETIGDPDMGVAAEYVAERYNITREMQDEYACLSYK 142
163941232  82 QCGAGLEAIRTACHFIQGGAGNCYIAGGVESTSTSPFQNRARFSPETIGDPDMGLAAEYVAEQYNITKEMQDEYACLSYK 161
16078099   81 QCGSGLEAVRYACSLIQAGAGTMYIAGGSESSSQSPFSERARFSPDAIGDPDMGIAAEYTAARYSISRSMQDEYALLSHQ 160
305673738 161 RSRNAHDGGFYREEIVP--LGELEmDEAFLKKRPIEAIISRAKPVFDtSSGTVTAANSSGISDGAAALLVLEEEKAASLG 238
154685487 161 RSIKAHEDGLYRPEILP--CHGFAaDENMLKKRNMEPLISRAKPVFQ-SGGSVTAANSCGISDGAAAVCVMEEQKARSLG 237
30021725  162 RTLQALEKGYIHDEIFS--FNGLL-DESIKLEMNYERIIKRTKPAFL-QNGTVTAGNSCGVNDGACAVLVMEEGQARKLG 237
218898718 162 RTLQALEKGYIHDEIFS--FNGLL-DESIKLEMNYERIIKRTKPAFL-QNGTVTAGNSCGVNDGACAVLVMEEGQARKLG 237
218236003 162 RTLQALEKGYIHDEIFS--FNGLL-DESIKPEMNYERIIKRTKPAFL-QNGTVTAGNSCGVNDGACAVLVMEEGQARKLG 237
294499253 164 RSWESFEKRLFEEETLP--LSNVMhDEAFMKNRNLTKLLQKASPVFLkKDGTVTAANSCGINDGACVTLVMEEQKARALG 241
295704605 164 RSWEAFEKRLFEEETLP--LPNVMhDEAFMKKRNLTKLLQKASPVFLkKEGTVTAANSCGINDGACITLVMEEQKARSLG 241
296504130 143 RTLQALEKGYIHDEIFS--FNGLL-DESIKPEMNYERIIKRTKPAFL-QNGTVTAGNSCGVNDGACAVLVMEEGQARKLG 218
163941232 162 RTLQALEKGYIQEEILPhyFNGLL-DESIKREMNYERMIKRTKPAFL-KNGTVTAGNSCGVNDGACAVLVMEEGQARKLG 239
16078099  161 RSRNAHDEGFYREEVVA--LGELEtDEAFLKTRPIEAIIPRAKPVFDtSSGTVTAANSSGIADGAAALLVMEEEKAAALG 238
305673738 239 YKPVLRFIGSAVSGIHPNYPPEAPVDAIRKLLSAHDVTPDDIDLYEINEAFAVKICVCSQELGIPFSKINVRGGALTLGH 318
154685487 238 LKPGLRFIGSAVSGVHPHYPSAAPVYAVKKLLKERDLSPDDIDIYEINEAFAVKICVFSQQLRVPYSKINVRGGALAVGH 317
30021725  238 YKPVLRFVRSAVVGVDPKLPGTGPIFAVNKLLNEMNMKVEDIDYFEINEAFASKVVACAKELQIPYEKVNVNGGAIALGH 317
218898718 238 YKPVLRFVRSAVVGVDPKLPGTGPIFAVNKLLNEMNVKVEDIDYFEINEAFASKVVACAKELQIPYEKVNVNGGAIALGH 317
218236003 238 YKPVLRFVRSAVVGVDPNLPGTGPIFAVNKLLNEMNVKVEDIDYFEINEAFASKVVACAKELQIPYEKVNVNGGAIALGH 317
294499253 242 FQPVLRFIDADISGVSPLYPAIAPVSAIKNILKRNSLTIDDIDLFEINEAFAVKVVACMQELGISEEKVNIRGGALTLGH 321
295704605 242 FQPVLRFIDADISGVSPLYPAIAPVSAIKNIVKRNSLTVDDIDLFEINEAFAVKVVACMQELGIREEKVNIRGGALTLGH 321
296504130 219 YKPVLRFVRSAVVGVDPKLPGTGPIFAVNKLLNEMNVKVEDIDYFEINEAFASKVVACAKELQIPYEKVNVNGGAIALGH 298
163941232 240 YKPVLRFVRSAVVGVDPNLPGTGPIFAVNKLLNEMNMKVEDIDYFEINEAFASKIVACAKELQIPFGKLNVNGGAIALGH 319
16078099  239 LKPVLRFIGSAVSGIHPNFPPAAPVVAIRQLLHTHDVTPDDIDLFEINEAFAVKICVCSQELGIPFSKINVRGGALALGH 318
305673738 319 PYGASGAALVTRLFYEAQRRtDCQYAVAAIGSGGGIGLALLFEVLA 364
154685487 318 PYGASGAALVTRLFYEAKRRpDARYAAAAIGSGGGVGLALLFEVLT 363
30021725  318 PYGASGAMLVTRLFYQAQRE-SMKYGIATLGIGGGIGIALLFEKVE 362
218898718 318 PYGASGAMLVTRLFYQAQRE-SMKYGIATLGIGGGIGIALLFEKVE 362
218236003 318 PYGASGAMLVTRLFYQAQRE-SMKYGIATLGIGGGIGIALLFEKVE 362
294499253 322 PYGASGAILATRLFYESKRR-DVRYVIAALGSGGGIGTAVLFEVIK 366
295704605 322 PYGASGAILATRLFYESKRR-DMRYVIAALGSGGGIGTAVLFEVIK 366
296504130 299 PYGASGAMLVTRLFYQAQRE-SMKYGIATLGIGGGIGIALLFEKVE 343
163941232 320 PYGASGAMLVTRLFYQAQRE-HMKYGITTLGIGGGIGLALLFEKVE 364
16078099  319 PYGASGAALVTRLFYEAKRRpDCQYAVAAIGSGGGIGLALLFEVLA 364
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap