Conserved Protein Domain Family
PRK06689

?
PRK06689: PRK06689 (this model, PSSM-Id:102500 is obsolete)
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 102500
View PSSM: PRK06689
Aligned: 10 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30022110    1 MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRTDEANTARTAALAAGFPDTVT 80 
52141468    1 MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRTDEANTARTAALAAGFPDTVT 80 
152976434   1 MQNVVITAAVRSPIGTFGGALKNITPVELVVPVLQEAVKQGGVEPHEVDEVILGHCIQRTDEANTARTAALAAGFPETVT 80 
163941764   1 MHNVVITAAVRSPIGTFGGALKNITPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRTDEANTARTAALAAGFPDTVT 80 
47529533    1 MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRTDEANTARTAALAAGFPDTVT 80 
30264098    1 MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRTDEANTARTAALAAGFPDTVT 80 
49186930    1 MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRTDEANTARTAALAAGFPDTVT 80 
42783123    1 MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRTDEANTARTAALAAGFPDTVT 80 
49478496    1 MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRTDEANTARTAALAAGFPDTVT 80 
118479230   1 MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRTDEANTARTAALAAGFPDTVT 80 
30022110   81 GYTIQRQCSSGMQAIMSAAMQIQLGVSDVVVAGGVEAMSSSPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETA 160
52141468   81 GYTIQRQCSSGMQAIMSAAMQIQLGVSEVVVAGGVEAMSSSPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETA 160
152976434  81 GYTIQRQCSSGMQAIMSAAMQIQLGISDVVVAGGVEAMSSSPYALKQHRWGQRLQHGEIRDTVWEVLEDPLHHMMMGETA 160
163941764  81 GYTIQRQCSSGMQAIMSAAMQIQLGVSDIVVAGGVEAMSSSPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETA 160
47529533   81 GYTIQRQCSSGMQAIMSAAMQIQLGVSEVVVAGGVEAMSSSPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETA 160
30264098   81 GYTIQRQCSSGMQAIMSAAMQIQLGVSEVVVAGGVEAMSSSPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETA 160
49186930   81 GYTIQRQCSSGMQAIMSAAMQIQLGVSEVVVAGGVEAMSSSPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETA 160
42783123   81 GYTIQRQCSSGMQAIMSAAMQIQLGVSEVVVAGGVEAMSSSPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETA 160
49478496   81 GYTIQRQCSSGMQAIMSAAMQIQLGVSEVVVAGGVEAMSSSPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETA 160
118479230  81 GYTIQRQCSSGMQAIMSAAMQIQLGVSEVVVAGGVEAMSSSPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETA 160
30022110  161 ENLVKQYEITREEQDEVALRSHTLALKAIESGYFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV 240
52141468  161 ENLVEQYEITREEQDEVALRSHTLALKAIESGYFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKGGSV 240
152976434 161 ENLVEQYNITREEQDEIALRSHRLALQAIESGYFDKQIVPITIKERRKEVVFSKDEHPRADITAEKLANLKPAFRKGGSV 240
163941764 161 ENLVEQYEITREEQDEVALRSHTLALQAMESGYFDDQIVPITIKERRKEVVFAKDEHPRADITAEKLAGLKPAFRKDGSV 240
47529533  161 ENLVEQYEITREEQDEVALRSHTLALKAIESGYFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV 240
30264098  161 ENLVEQYEITREEQDEVALRSHTLALKAIESGYFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV 240
49186930  161 ENLVEQYEITREEQDEVALRSHTLALKAIESGYFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV 240
42783123  161 ENLVEQYEITREEQDEVALRSHTLALKAIESGYFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV 240
49478496  161 ENLVEQYEITREEQDEVALRSHTLALKAIESGYFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV 240
118479230 161 ENLVEQYEITREEQDEVALRSHTLALKAIESGYFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV 240
30022110  241 TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLEKVDWSLEDADLLEINEAFAA 320
52141468  241 TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLEKVDWSLEDADLFEINEAFAA 320
152976434 241 TAGNASGINDGSAVLVVMSEEKAKEKGLQPLAKVVGYSVAGVDPKIMGIGPAPAIRKGLKKVNWSLEDADLLEINEAFAA 320
163941764 241 TAGNSSGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLEKVDWSLEDADLLEINEAFAA 320
47529533  241 TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLEKVDWSLEDADLLEINEAFAA 320
30264098  241 TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLEKVDWSLEDADLLEINEAFAA 320
49186930  241 TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLEKVDWSLEDADLLEINEAFAA 320
42783123  241 TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLEKVDWSLEDADLLEINEAFAA 320
49478496  241 TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLEKVDWSLEDADLLEINEAFAA 320
118479230 241 TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLEKVDWSLEDADLLEINEAFAA 320
30022110  321 QYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSLIHELKRRGLEKGIASLCVGGGIGVALFIEAL 391
52141468  321 QYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSLIHELKRRGLEKGIASLCVGGGIGVALFIEAL 391
152976434 321 QYLAVEKELGLNREKVNVNGSGVGLGHPIGCTGARITVSLIHELKRRGLKKGIASLCVGGGIGVALFIEAL 391
163941764 321 QYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSLIHELKRRGLEKGIASLCVGGGIGVALFIEAL 391
47529533  321 QYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSLIHELKRRGLEKGIASLCVGGGIGVALFIEAL 391
30264098  321 QYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSLIHELKRRGLEKGIASLCVGGGIGVALFIEAL 391
49186930  321 QYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSLIHELKRRGLEKGIASLCVGGGIGVALFIEAL 391
42783123  321 QYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSLIHELKRRGLEKGIASLCVGGGIGVALFIEAL 391
49478496  321 QYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSLIHELKRRGLEKGIASLCVGGGIGVALFIEAL 391
118479230 321 QYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSLIHELKRRGLEKGIASLCVGGGIGVALFIEAL 391
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap