Conserved Protein Domain Family
dnaE

?
PRK06637: dnaE (this model, PSSM-Id:102476 is obsolete)
DNA polymerase III subunit alpha; Validated
Statistics
?
PSSM-Id: 102476
View PSSM: PRK06637
Aligned: 11 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 67459636     1 MRPEFIHLRTQSSYSFLESALTIEKVVELASSNKMPAICLADKGNLFGSLEFALYAVKKGLQPIHGVILNIKYDIDIFAQ 80
gi 157826231    1 MQPEFIHLRTQSSYSFLESALTLEKIVELASSNKMPAICLADRGNLFGSLEFALYAVKKGLQPIHGVILNIKYDVDIFAQ 80
gi 157827786    1 MQTEFIHLRTQSSYSFLASALTTEKIVELASSYKMAAICLTDKENLFGSLEFALYAIKKGLQPIHGVILNIQYETGVFAE 80
gi 91204889     1 MQTEFIHLRTQSSYSFLASALTTEKIVELASSYKMAAICLTDKENLFGSLEFALYAIKKGLQPIHGVILNIQYETGVFAE 80
gi 157804147    1 MQPEFIHLRTQSSYSFLESALTIEKIVELASLNKMSAICLADSGNLFGSLEFALYAVKKGLQPIHGVILNIQYDINIFAQ 80
gi 15893134     1 MRPEFIHLRTQSSYSFLESALTIEKVVELASSNKMPAICLADKGNLFGSLEFALCAVKKGLQPIHGVILNIKYDIDIFAQ 80
gi 157964927    1 MRPEFIHLRTQSSYSFLESALTIEKVVELASANKMPAICLADKGNLFGSLEFALYAVKKGLQPIHGVILNIKYDIDIFAQ 80
gi 15604610     1 MQPEFIHLRTQSSYSFLESALTIEKVVELALLHKMPALCLSDRGNLFGSLEFSLYAVKKKLQPIHGVILNIQYDINAFAQ 80
gi 51473946     1 MQSEFIHLRTQSSYSFLESALTIEKVVELALLHKMPALCLSDRGNLFGSLEFALYAVKKKLQPIHGVILNIQYDINVFAQ 80
gi 157829043    1 MRPEFIHLRTQSSYSFLESALTIEKVVELASSNKMPAICLADKGNLFGSLEFALCAVKKGLQPIHGVILNIKYDIDIFAQ 80
gi 165933767    1 MRPEFIHLRTQSSYSFLESALTIEKVVELASSNKMPAICLADKGNLFGSLEFALCAVKKGLQPIHGVILNIKYDIDIFAQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 67459636    81 ILLIAKDETGYKNLLKLSSLTFTKNDRKLCDHIDFEDLIEYQEGLIALCCYTDGIVGKCLLARSEEQAMLFARKLQDILG 160
gi 157826231   81 ILLIAKDETGYKNLLKLSSLTFTKNDRKICDHITFEDLIKYQEGLIALCCYTDGIVGKCLLAREQEQAMLFARTLQEILG 160
gi 157827786   81 ILLIAKDETGYKNLLKLSSITFTTNDRKICNHITFEDLKEHQEGLITLCCYTEGVIGKCLLANKEEQAEMFARNLQEIFG 160
gi 91204889    81 ILLIAKDETGYKNLLKLSSITFTTNDRKICNHITFEDLKEHQEGLITLCCYTEGVIGKCLLANKEEQAEMFARNLQEIFG 160
gi 157804147   81 ILLIAKDEVGYKNLLKLSSLTVTKNDRKICDHINFEDLVKYQEGLIALCCYTDGIVGKCLLARNEEQAILFARKLQEILA 160
gi 15893134    81 ILLIAKDETGYKNLLKLSSLTFTKNDRKICDHIDFEDLIEYQEGLIGLCCYTDGIVGKCLLARNEEQAMLFARKLQEILG 160
gi 157964927   81 ILLIAKDETGYKNLLKLSSLTFTKDDRKICDHIDFEDLIEYQEGLIGLCCYTDGIVGKCLLARNEEQAMLFARKLQEILG 160
gi 15604610    81 ILLIAKDETGYKNLLKLSSLTFTKNDRKICEHIGFEDLIKYQEGVIALCCYTDGIVGKCLLARKQEQAILFARRLQAILG 160
gi 51473946    81 ILLIAKDETGYKNLLKLSSLTFTKNDRKICDHINFEDLIKYQEGLIALCCYTDGIVGKCLLARKQEHAIMFARRLQAILG 160
gi 157829043   81 ILLIAKDETGYKNLLKLSSLTFTKNDRKICDHINFEDLIEYQEGLIGLCCYTDGIVGKCLLARNEEQAMLFARKLQEILG 160
gi 165933767   81 ILLIAKDETGYKNLLKLSSLTFTKNDRKICDHINFEDLIEYQEGLIGLCCYTDGIVGKCLLARNEEQAMLFARKLQEILG 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 67459636   161 DRFYFEIMRHDLPEEQFIEDSYIRIAAELAIPLVATNKVLFSEKTMHDAHDVLLCISAGVTKEYPDRKTVSENCYFRSPH 240
gi 157826231  161 DRFYFEIMRHDLPEEQFIEDSYIKIASELSIPLVATNKVLFSEKSMHDAHDVLLCISAGVTKEYPDRKTVSENCYFRSPH 240
gi 157827786  161 DRFYFEIMRHDLPEEQLIEDNYIKIASKLNIPLVATNKVLFSKKSMHDAHDVLLCISAGVTKEYPDRKTVSENCYFKSAK 240
gi 91204889   161 DRFYFEIMRHDLPEEQLIEDNYIKIASKLNIPLVATNKVLFSKKSMHDAHDVLLCISAGVTKEYPDRKTVSENCYFKSAK 240
gi 157804147  161 DRFYFEIMRHDLPEEQFIEDHYIKIAAELAIPLVATNKVLFSEKSMHYAHDVLLCISAGVTKEYPDRKTVSENCYFKSPR 240
gi 15893134   161 DRFYFEIMRHELPEEQFIEDSYIRIAAELAIPLVATNKVLFSEKSMHDAHDVLLCISAGVTKEYLDRKTVSENCYFKSPH 240
gi 157964927  161 DRFYFEIMRHELPEEQFIEDSYIRIAAELAIPLVATNKVLFSEKSMHDAHDVLLCISAGVTKEYPDRKTVSENCYFRSPH 240
gi 15604610   161 DRFYFEIMRHDLPEEQFIENSYIQIASELSIPIVATNKVLFSEKSMHYAHDVLLCISEGVTKEYPDRKTVSENCYFKSPA 240
gi 51473946   161 DRFYFEIMRHDLPEEQFIENSYIQIASELSIPIVATNKVLFSEKSMHYAHDVLLCISEGVTKEYPDRKTVSENCYFKSPA 240
gi 157829043  161 DRFYFEIMRHELPEEQFIEDSYIRIAAELAIPLVATNKVLFSEKSMHDAHDVLLCISAGVTKEYLDRKTVSENCYFRSPH 240
gi 165933767  161 DRFYFEIMRHELPEEQFIEDSYIRIAAELAIPLVATNKVLFSEKSMHDAHDVLLCISAGVTKEYLDRKTVSENCYFRSPH 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 67459636   241 EMIELFSDLPSAIQNTVNLRERCYFAAHANPPMLPNFATKDISETDLIRKDAKEGLLARLATKFKSENIPLQNQEELKTE 320
gi 157826231  241 EMREIFSDLPNAIQNTVNLRERCYFAAHANPPMLPNFATKDISETDLIRKDAKEGLLARLATKFKSEHISLENQEELKTE 320
gi 157827786  241 EMIELFADLPSAIENTVNLTQRCYFAAHTNPPMLPNFATKDISETDLIRKEAKDGLLARLDTKFKSEHISIEHQESIKTE 320
gi 91204889   241 EMIELFADLPSAIENTVNLTQRCYFAAHTNPPMLPNFATKDISETDLIRKEAKDGLLARLDTKFKSEHISIEHQESIKTE 320
gi 157804147  241 EMIELFSDLPAAIENTVNLRERCYFAAHANPPMLPNFATKDISETDLIRKEATEGLLARLAIKFKSENISLENQEELKTE 320
gi 15893134   241 EMIELFSDLPSAIQNTVNLRERCYFAAHANPPMLPNFATENISETDLIKKDAKEGLLARLATKFKSENIALENQEALKTE 320
gi 157964927  241 EMIELFSDLPSAIQNTVNLRERCYFAAHANPPMLPNFATKDISETDLIRKDAKEGLLARLATKFKSENISLENQEELKTE 320
gi 15604610   241 EMRKLFSDLPNAIQNTINLRERCYFAAHPNPPMLPNFSTQDISETYLIRKYATEGLLARLVTKFKAENISLEHQEKLKTE 320
gi 51473946   241 EMKKLFSDLPNAIQNTVNLRERCYFAAHPNPPMLPNFSTQDISETYLIRKYAKEGLLARLVTKFKAENISREHQEKLKTE 320
gi 157829043  241 EMIELFSDLPSAIQNTVNLRERCYFAAHANPPMLPNFATKDISETDLIKKDATEGLLARLAAKFKSENIALENQEALKTE 320
gi 165933767  241 EMIELFSDLPSAIQNTVNLRERCYFAAHANPPMLPNFATKDISETDLIKKDATEGLLARLAAKFKSENIALENQEALKTE 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 67459636   321 YFARLNYELDIICNMNFAGYFLIVSDFIKWSKKEGILVGPGRGSGAGSVVAWSLLITDLDPIKFGLLFERFLNPERISMP 400
gi 157826231  321 YFARLNYELDIICNMNFAGYFLIVSDFIKWSKKKGILVGPGRGSGAGSVVAWSLLITDLDPIKFGLLFERFLNPERISMP 400
gi 157827786  321 YFARLDYELNIICSMNFAGYFLIVSDFIKWSKKQGILVGPGRGSGAGSVVAWSLLITDLDPIKFGLLFERFLNPDRISMP 400
gi 91204889   321 YFARLDYELNIICSMNFAGYFLIVSDFIKWSKKQGILVGPGRGSGAGSVVAWSLLITDLDPIKFGLLFERFLNPDRISMP 400
gi 157804147  321 YLSRLNYELDIICNMNFAGYFLIVSDFIKWSKQEGILVGPGRGSGAGSVVAWSLLITDLDPIKFGLLFERFLNPERISMP 400
gi 15893134   321 YFARLNYELDIICNMNFAGYFLIVSDFIKWSKKEGILVGPGRGSGAGSVVAWSLLITDLDPIKFGLLFERFLNPERISMP 400
gi 157964927  321 YFARLNYELDIICNMNFAGYFLIVSDFIKWSKKEGILVGPGRGSGAGSVVAWSLLITDLDPIKFGLLFERFLNPERISMP 400
gi 15604610   321 YFTRLNYELDIICNMNFAGYFLIVSDFIKWSKKQGILVGPGRGSGAGSVVAWSLLITDLDPIKFGLLFERFLNPERISMP 400
gi 51473946   321 YFTRLNYELDIICNMNFAGYFLIVSDFIKWSKKHGILVGPGRGSGAGSVVAWSLLITDLDPIKFGLLFERFLNPERISMP 400
gi 157829043  321 YFARLNYELDIICNMNFAGYFLIVSDFIKWSKKEGILVGPGRGSGAGSVVAWSLLITDLDPIKFGLLFERFLNPERISMP 400
gi 165933767  321 YFARLNYELDIICNMNFAGYFLIVSDFIKWSKKEGILVGPGRGSGAGSVVAWSLLITDLDPIKFGLLFERFLNPERISMP 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 67459636   401 DFDIDFCQERREEVINYVRSKYGNNRVGQIITFGKMQAKAVIKDVARVLSLPYKFADYLTELVPFSAVNPVSLEQAMREV 480
gi 157826231  401 DFDIDFCQERREEVINYVRSKYGHNRVGQIITFGKMQAKAVIKDVARVLSLPYKFADYLTELVPFSAVNPVTLEQAMREV 480
gi 157827786  401 DFDIDFCQERREEVINYVRSKYGNNRVGQIITFGKMQAKAVIKDVARVLSLPYKFADYLTELVPFSAINPVTLEQAIREV 480
gi 91204889   401 DFDIDFCQERREEVINYVRSKYGNNRVGQIITFGKMQAKAVIKDVARVLSLPYKFADYLTELVPFSAINPVTLEQAIREV 480
gi 157804147  401 DFDIDFCQERREEVINYVRSKYGYNRVGQIITFGKMQAKAVIKDVARVLSLPYKFADYITELVPFSAVNPVTLEQAMHEV 480
gi 15893134   401 DFDIDFCQERREEVINYVRSKYGNNRVGQIITFGKMQAKAVIKDVARVLSLPYKFADYLTELVPFSAVNPVSLEQAMREV 480
gi 157964927  401 DFDIDFCQERREEVINYVRSKYGNNRVGQIITFGKMQAKAVIKDVARVLSLPYKFADYLTELVPFSAVNPVSLEQAMREV 480
gi 15604610   401 DFDIDFCQERREEVINYVRSKYGPNRVGQIITFGKMQAKAVIKDVARVLSLPYKLADYLTELVPFSAINPVSLEQAIREV 480
gi 51473946   401 DFDIDFCQERREEVINYVCSKYGNNRVGQIITFGKMQAKAVIKDVARVLSLPYKCADYLTELVPFSAVNPVSLEQAIREV 480
gi 157829043  401 DFDIDFCQERREEVINYVRSKYGNNRVGQIITFGKMQAKAVIKDVARVLSLPYKFADYLTELVPFSAVNPVSLEQAMREV 480
gi 165933767  401 DFDIDFCQERREEVINYVRSKYGNNRVGQIITFGKMQAKAVIKDVARVLSLPYKFADYLTELVPFSAVNPVSLEQAMREV 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 67459636   481 PELANAAKGNGLYNLEGEAELIKLVLDTSLILEGLHRHSSTHAAGIVIAGTDLVDIVPVYKDANSDMLVVGYSMKYSEIA 560
gi 157826231  481 PELANAAKGNGLYNLEGEAELIKLVLDTSLILEGLHRHVSTHAAGIVIACTDLVDIVPVYKDANSDMLVVGYSMKYSEIA 560
gi 157827786  481 PELANAAKGNGLYNLEGELELIKLVLDTSLILEGLHRHSSTHAAGIVIAGTDLVDIVPVYKDANSDMLVVGYSMKYCELA 560
gi 91204889   481 PELANAAKGNGLYNLEGELELIKLVLDTSLILEGLHRHSSTHAAGIVIAGTDLVDIVPVYKDANSDMLVVGYSMKYCELA 560
gi 157804147  481 PELANAAKGNGLYNLEGEAELIKLVLDTSLILEGLHRHSSTHAAGIVIAGTDLVDIVPVYKDANSDMLIVGYSMKYSEIA 560
gi 15893134   481 PELANAAKGNGLYNLDGEAELIKLVIDTSLILEGLHRHSSTHAAGIVIAGTDLVDIVPVYKDANSDMLIVGYSMKYSEIA 560
gi 157964927  481 PELANAAKGNGLYNLDGEAELIKLVLDTSLILEGLHRHSSTHAAGIVIAGTDLVDIVPVYKDANSDMLVVGYSMKYAEIA 560
gi 15604610   481 PELANAAKGNGLYNLEGDAELIKLVLDTSLILEGLHRHSSTHAAGIVIAGTDLVDIVPVYKDANADMLIVGYSMKYSEIA 560
gi 51473946   481 PELANAAKGKGLYNLEGDAELIKLVLDTSLILEGLHRHSSTHAAGIVIAGTDLVDIVPVYKDANSDMLIVGYSMKYSEIA 560
gi 157829043  481 PELANAAKGNGLYNLDGEAELIKLVIDTSLILEGLHRHSSTHAAGIVIAGTDLVDIVPVYKDSNSDMLVVGYSMKYSEIA 560
gi 165933767  481 PELANAAKGNGLYNLDGEAELIKLVIDTSLILEGLHRHSSTHAAGIVIAGTDLVDIVPVYKDSNSDMLVVGYSMKYSEIA 560
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 67459636   561 GLIKFDFLGLQTLTVITDCKKLLKEQGIEVDFNNMTFDDNKTYQMLCKGKGVGVFQFESIGMKDALRRLKPDSIHDLIAL 640
gi 157826231  561 GLIKFDFLGLQTLTVITDCKKLLKEQGIEVDFNNMTFDDNKTYQMLCKGKGVGVFQFESIGMKDALRRLKPDSIHDLIAL 640
gi 157827786  561 GLIKFDFLGLQTLTVITDCKKLLKEQNIEIDFNDMTFDDEKTYQMLCKGKGVGVFQFESVGMKDALRRLKPDSIHDLIAL 640
gi 91204889   561 GLIKFDFLGLQTLTVITDCKKLLKEQNIEIDFNDMTFDDEKTYQMLCKGKGVGVFQFESVGMKDALRRLKPDSIHDLIAL 640
gi 157804147  561 GLIKFDFLGLQTLTVITDCKKLLKERGIDVDLNNMTFDDNKTYQMLCQGKGVGVFQFESVGMKDALRRLKPDSIHDLIAL 640
gi 15893134   561 GLIKFDFLGLQTLTVITDCKKLLKEQGIEVDFNNMTFDDNKTYQMLCKGKGVGVFQFESIGMKDALRRLKPDSIHDLIAL 640
gi 157964927  561 GLIKFDFLGLQTLTVITDCKKLLKEQGIEVDFNNMTFDDNKTYQMLCKGKGVGVFQFESIGMKDALRRLKPDSIHDLIAL 640
gi 15604610   561 GLIKFDFLGLQTLTVITNCKKLLKEQGIKIDFDDMTFDDKKTYQMLCKGKGVGVFQFESIGMKDALRRLKPDSIHDLIAL 640
gi 51473946   561 GLIKFDFLGLQTLTVITNCKKLLKEQGIEIDFDDMTFDDNKTYQMLCKGKGVGVFQFESIGMKDALRRLKPDSIHDLIAL 640
gi 157829043  561 GLIKFDFLGLQTLTVITDCKKLLKEQGIEVDFNNMTFDDNKTYQMLCKGKGVGVFQFESIGMKDALRRLKPDSIHDLIAL 640
gi 165933767  561 GLIKFDFLGLQTLTVITDCKKLLKEQGIEVDFNNMTFDDNKTYQMLCKGKGVGVFQFESIGMKDALRRLKPDSIHDLIAL 640
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 67459636   641 GALYRPGPMENIPTYIACKHKLQQPDYLHELLKPILEETYGVVIYQEQVQRIAQILAGYTLGAADLLRRAMGKKIKKEME 720
gi 157826231  641 GALYRPGPMENIPTYIACKHKLKQPDYLHELLKPILEETYGVVIYQEQVQRIAQILAGYTLGAADLLRRAMGKKIKKEME 720
gi 157827786  641 GALYRPGPMENIPTYIACKHKLQQPDYLHELLKPILEETYGVVIYQEQVQRIAQVLAGYTLGAADLLRRAMGKKIKAEME 720
gi 91204889   641 GALYRPGPMENIPTYIACKHKLQQPDYLHELLKPILEETYGVVIYQEQVQRIAQVLAGYTLGAADLLRRAMGKKIKAEME 720
gi 157804147  641 GALYRPGPMENIPTYIACKHKLQQPDYLHELLKPILEETYGVVIYQEQVQRIAQVLAGYTLGAADLLRRAMGKKIKKEME 720
gi 15893134   641 GALYRPGPMENIPTYIACKHKLQQPDYLHELLQPILEETYGVVIYQEQVQRIAQVLAGYTLGAADLLRRAMGKKIKKEME 720
gi 157964927  641 GALYRPGPMENIPTYIACKHKLQQPDYLHELLKPILEETYGVVIYQEQVQRIAQVLAGYTLGAADLLRRAMGKKIKKEME 720
gi 15604610   641 GALYRPGPMENIPTYIACKHKLQQPDYLHKLLEPILEETYGVVIYQEQVQRIAQVLAGYTLGAADLLRRAMGKKIKKEME 720
gi 51473946   641 GALYRPGPMENIPTYIACKHKLQQPDYLHKLLKPILEETYGVVIYQEQVQRIAQVLAGYTLGAADLLRRAMGKKIKKEME 720
gi 157829043  641 GALYRPGPMENIPTYIACKHKLQQPDYLHELLKPILEETYGVVIYQEQVQRIAQVLAGYTLGAADLLRRAMGKKIKKEME 720
gi 165933767  641 GALYRPGPMENIPTYIACKHKLQQPDYLHELLKPILEETYGVVIYQEQVQRIAQVLAGYTLGAADLLRRAMGKKIKKEME 720
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 67459636   721 EQEEIFVKGAIANNISESQAKSIFATVAKFAGYGFNKAHAAAYGVISYQTAYLKANYPAEFLVACLNLELNNHDKINLFL 800
gi 157826231  721 EHEEIFVKGAIANNISESQAKSIFATVAKFAGYGFNKAHAAAYGVISYQTAYLKANYSAEFLVACLNLELNNHDKINLFL 800
gi 157827786  721 QQEEIFVKGAIANNISEAQAKSIFVTVAKFAGYGFNKAHAAAYGVISYQTAYLKANYPAEFVVACLNLELNNHDKINLFL 800
gi 91204889   721 QQEEIFVKGAIANNISEAQAKSIFATVAKFAGYGFNKAHAAAYGVISYQTAYLKANYPAEFVVACLNLELNNHDKINLFL 800
gi 157804147  721 EQEEIFVKGAVANNISASQAKSIFATVAKFAGYGFNKAHAAAYGVISYQTAYLKANYPAEFLVACLNLELNNHDKINLFL 800
gi 15893134   721 EQEEIFVKGAIANNISESQAKSIFATVAKFAGYGFNKAHAASYGVISYQTAYLKANYPAAFLVACLNLELNNHDKINLFL 800
gi 157964927  721 EQEEIFVKGAIANNISESQAKSIFATVAKFAGYGFNKAHAASYGVLSYQTAYLKANYPAEFLVACLNLELNNHDKINFFL 800
gi 15604610   721 EQEEIFVKGAIANNISPSQAKSIFSTVAKFAGYGFNKAHAAAYGVISYQTAYLKANYPAEFLVACLNLELNNHDKINLFL 800
gi 51473946   721 EQEEIFVKGAIANNISQSQAKSIFATVAKFAGYGFNKAHAAAYGVISYQTAYLKANYPAEFLVACLNLELNNHDKINLFL 800
gi 157829043  721 EQEEIFVKGAIANNISESQAKSIFATVAKFAGYGFNKAHAASYGVISYQTAYLKANYPAEFLVACLNLELNNHDKINLFL 800
gi 165933767  721 EQEEIFVKGAIANNISESQAKSIFATVAKFAGYGFNKAHAASYGVISYQTAYLKANYPAEFLVACLNLELNNHDKINLFL 800
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 67459636   801 QEAKDSGIKIIAPNINISEGYFSVK---SVIpqaatchpqgplCHPRVGGYPEKVktvlnhESMKMDSRFCGNDIKGSRn 877
gi 157826231  801 QEAKDSGIKIIAPNINSSEGYFTTChfgSAL------------CHPRVGVDPEKT------SEMKMDSRFCENNIESTGy 862
gi 157827786  801 QEAKDNNIKIIAPNINISGGYFS--------------------VKSVIPQLDRSI------HGDQLKDTAVKPQYDIDS- 853
gi 91204889   801 QEAKDNNIKIIAPNINISGGYFS--------------------VKSVIPRLDCGI------HGDQLKDTAVKPQYDIDS- 853
gi 157804147  801 QEAKDSGIKIIAPNINISEGYFIVK---SVIpqavtchshevlCHTRVGVDPEKI------SEMKMDDYFRGNDKEGTEn 871
gi 15893134   801 QEAKDNGIKIIAPNINISEGYFSVKfsdTVIph---------sVKPVIPRLDRGI------QKISKDT-VVKPRCDIAG- 863
gi 157964927  801 QEAKDNGIKITAPNINISEGYFSVKfsdTVIph---------sVRPVIPRLDRGI------QEISKDT-VVKPRYDIAG- 863
gi 15604610   801 QEAKDNGIKIIAPNINISEGYFSVKssnTVIth---------sTKSVISRLNCDI------KKIAKDTAVKPLYCKDES- 864
gi 51473946   801 QEAKDNGIKIIAPNINISEGYFSVKssdTVIth---------nTKPLIPRLNNEI------D--IKDTAVKSLYYKDES- 862
gi 157829043  801 QEAKDNGIKIIAPNINISEGYFSVQfsdTVIph---------sVKPVIPRLDRGI------QEISKDT-VVKPRYNIAG- 863
gi 165933767  801 QEAKDNGIKIIAPNINISEGYFSVQfsdTVIph---------sVKPVIPRLDRGI------QEISKDT-VVKPRYNIAG- 863
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 67459636   878 diedtgydkeksTIIFALGAIKGVTPNFGKLVTDERKARGAFKSITDFIERLPLKSINSKLLENLIKSGCFDELHDNRLQ 957
gi 157826231  863 dk-------eerAIIFALGAIKGVTPSFGKLVTDERKARGAFKSITDFIERLPPKSINSKLLENLIKSGCFDELHDNRLQ 935
gi 157827786  854 ------------SIIFALGAIKGVTPNFGKLVTDERNARGAFKSIVDFIERLPPKAINSKLLENLIKAGCFDELHDNRLQ 921
gi 91204889   854 ------------SIIFALGAIKGVTPNFGKLVTDERNARGAFKSIVDFIERLPPKAINSKLLENLIKAGCFDELHDNRLQ 921
gi 157804147  872 diksceydkevsAIIFALGAIKGVTPNFGKLVTDERKARGPFKSITDFIERLPPKSINSKLLENLIKSGCFDELHDNRLQ 951
gi 15893134   864 ------------AIIFALGAIKGVTPNFGKLVTDERKARGAFKSITDFIERLPPKSINSKLLENLIKSGCFDELHDNRLQ 931
gi 157964927  864 ------------AIIFALGAIKGVTPNFGKLVTDERKARGAFKSITDFIERLPPKSINSKLLENLIKSGCFDELHDNRLQ 931
gi 15604610   865 ------------TIIFALGAIKGVTANFGKLVTDERKARGAFKSITDFIERLPPKSINSKLLENLIKAGCFDELHDNRLQ 932
gi 51473946   863 ------------TIIFALGAIKGVTPNFGKLVTDERKARGAFKSITDFIERLPPKSINSKLLENLIKAGCFDELHDNRLQ 930
gi 157829043  864 ------------AIIFALGAIKGVTPNFGKLVTDERKARGAFKSITDFIERLPPKSINSKLLENLIKSGCFDELHDNRLQ 931
gi 165933767  864 ------------AIIFALGAIKGVTPNFGKLVTDERKARGAFKSITDFIERLPPKSINSKLLENLIKSGCFDELHDNRLQ 931
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 67459636   958 LFSSISKLLAYSASYHAEQESNQFSLIKVSSLSPNILIASDYADNNTLAFYEFESMGLFISNHPLTQYQEIFSRLNILNT 1037
gi 157826231  936 LFLSISKLLAYSTSYHEEQESNQFSLIKVSSLSPTILVSSDYADKNTLAFYEFESMGLFISNHPLTEYQEIFSRLNILNT 1015
gi 157827786  922 LFLSISKLLAYSVSYHEEQASNQFSLIKVSSLSKEILVSSDYADKNTLAFYEFEAMGLFISNHPLTEYKEIFNRLNILSS 1001
gi 91204889   922 LFLSISKLLAYSVSYHEEQASNQFSLIKVSSLSKEILVSSDYADKNTLAFYEFEAMGLFISNHPLTEYKEIFNRLNILSS 1001
gi 157804147  952 LFLSIPKLLSYATSYHKEQASNQFSLIKVSSLSPTILIDSNYADKNTLAFYEFEAMGLFISNHPLTQYQEIFSRLNILNT 1031
gi 15893134   932 LLSSIPKLLSYSTAYHEEQESNQFSLIKVSSLSPTILVSSDYADKNTLAFYEFEAMGLFISNHPLTEYQEIFSRLNILNT 1011
gi 157964927  932 LLSSIPKLLSYATSYHEEQESNQFSLIKVSSLSPTILVSSDYADKNTLAFYEFEAMGLFISNHPLTEYQEIFSRLNILNT 1011
gi 15604610   933 LFLSIPKLIAYSTSYHQEQESNQFSLIKVSSLSPTILVSSDYADKNTLAFYEFEAMGLFLSNHPLTEYQGIFSRLNILNT 1012
gi 51473946   931 LFLSVPKLIAYSTSYHQEQESNQFSLIKVSSLSPTILVSSNYADKNTLAFYEFESMGLFISNHPLTEYQEIFSRLNILNT 1010
gi 157829043  932 LLSSIPKLLSYSTAYHEEQESNQFSLIKVSSLSPTILVSSDYADKNTLAFYEFEAMGLFISNHPLTEYQEIFSRLNILNT 1011
gi 165933767  932 LLSSIPKLLSYSTAYHEEQESNQFSLIKVSSLSPTILVSSDYADKNTLAFYEFEAMGLFISNHPLTEYQEIFSRLNILNT 1011
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 67459636  1038 ADLHNNLPDGTNRVNLAGVIQKKDSRMSARGRFVTLVLSDPENIFELSIFSEEVLKDYVHLLDVKSLVVVNCDIVKDEGG 1117
gi 157826231 1016 AYLYNNLPEGTNRVNLAGVIQKKDSRMSARGRFVTLVLSDPENIFELSVFSEEVLKDYVHLLDVKSLVVVNCDVVKDEGG 1095
gi 157827786 1002 ADLHNNLPDGTNRVMIAGVIQKKDSRMSARGRFVTLVLSDPENIFELSIFSEEVLKDYVHLLDVKSLVVVNCDIIKDEGG 1081
gi 91204889  1002 ADLHNNLPDGTNRVMIAGVIQKKDSRMSARGRFVTLVLSDPENIFELSIFSEEVLKDYVHLLDVKSLVVVNCDIIKDEGG 1081
gi 157804147 1032 ADLHNKLPYGTTRVNLAGVIQKKDSRMSVRGRFVTLVLSDPENIFELSIFSEEVLKDYVHLLDVKSLVVVNCDVFKDEGG 1111
gi 15893134  1012 ADLHNNLPDGTNRVNLAGVIQKKDSRMSARGRFVTLVLSDPENIFELSIFSEEVLKDYVHLLDVKSLVVVNCDIVKDEGG 1091
gi 157964927 1012 ADLHNNLPDGTNRVSLAGVIQKKDSRMSARGRFVTLVLSDPENIFELSIFSEEVLKDYVHLLDVKSLVVVNCDIVKDEGG 1091
gi 15604610  1013 RDLYNKLPNGTNRVTLAGVIQKKDSRMSARGRFVTLVLSDPENIFELTIFSEEVLKDYVHLLDVKSLVVVNCDVVKDEGG 1092
gi 51473946  1011 RDLYNKLPNGTNQVTLAGVIQKKDSRMSARGRFVTLVLSDPENIFELTIFSEEVLKDYVHLLDVKSLVVVNCDIVKDEGG 1090
gi 157829043 1012 ADLHNNLPDGTNRVNLAGVIQKKDSRMSARGRFVTLVLSDPENIFELSIFSEEVLKDYVHLLDVKSLVVVNCDIVKDEGG 1091
gi 165933767 1012 ADLHNNLPDGTNRVNLAGVIQKKDSRMSARGRFVTLVLSDPENIFELSIFSEEVLKDYVHLLDVKSLVVVNCDIVKDEGG 1091
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 67459636  1118 IKLTAKSFSSIEDAINNKQFELQLYPQNHEELRQIVTLLAARTNNRDQSNAKATIYLQSEGVKNFVAKITLPEKFFLQGQ 1197
gi 157826231 1096 IKLTAKSFSSIEDAINNKQFELQLYPKNYEELEQIVTLLSARTNNGDHSNAKATIYLQSEDVKNFVAKITLSEQFFLQVQ 1175
gi 157827786 1082 IKITAKSFSSIENATGNQQFDLQLYPKNDEELEQIITLLSARINNDEQSNTIATIYLSNKSVKNFVAKITFPEKFFLKGQ 1161
gi 91204889  1082 IKITAKSFSSIENATGNQQFDLQLYPKNDEELEQIITLLSARINNDEQSNTIATIYLSNKSVKNFVAKITFPEKFFLKGQ 1161
gi 157804147 1112 IKLTAKSFSSIEDVINNKQFELKLYPQNYEELRQILMMLAARTNN-NESNTKATIYLQSEEVKNFVAKITLPDKFFLQAQ 1190
gi 15893134  1092 IKLTAKSFSSIEDAINNKQFELQFYPQNHEELRQIVTLLAARINNEDQSNAKATIYLQSADVKNFVAKITLPEKFLLQGQ 1171
gi 157964927 1092 IKLTAKSFSSIEDAINNKQFELQFYPQNHEELRQIVTLLAARINNEDQSNARATIYLQSADVKNFVAKITLPEKFLLQGQ 1171
gi 15604610  1093 IKLTAKSFLSIEDVMNNRQFELQLYPQNYAELEQIITLLASRTSNGYQSNAKATIYLQSKDVKHFIAKITLSETFFLQVQ 1172
gi 51473946  1091 IKLTAKSFLSIEDAINNRQFELQLYPQNYAELEQIITLLVSRTGHGYQSNAKATIYLQSKDVKHFVAKITLSETFFLQVQ 1170
gi 157829043 1092 IKLTAKSFSSIEDAINNKQFELQFYPQNHEELRQIVNLLAARINNEDQSNAKATIYLQSADVKNFVAKITLPEKFLLQGQ 1171
gi 165933767 1092 IKLTAKSFSSIEDAINNKQFELQFYPQNHEELRQIVNLLAARINNEDQSNAKATIYLQSADVKNFVAKITLPEKFLLQGQ 1171
                        1210
                  ....*....|
gi 67459636  1198 DFEILKGYSK 1207
gi 157826231 1176 DFEILKGYSK 1185
gi 157827786 1162 DFEILSIYQN 1171
gi 91204889  1162 DFEILSIYQN 1171
gi 157804147 1191 DFEILKGYSK 1200
gi 15893134  1172 DFEILKGYSK 1181
gi 157964927 1172 DFEILKGYSK 1181
gi 15604610  1173 DFEVLNQYIR 1182
gi 51473946  1171 DFEILSQYIR 1180
gi 157829043 1172 DFEILKGYSK 1181
gi 165933767 1172 DFEILKGYSK 1181
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap