Conserved Protein Domain Family
PRK06633

?
PRK06633: PRK06633 
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 168632
View PSSM: PRK06633
Aligned: 7 rows
Threshold Bit Score: 782.678
Threshold Setting Gi: 91204954
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15604571    1 MTKQVYITHAKRTAFGSFMGSLSTIPAPMLAAYLIKDILQNSKIEPALVNEVILGQVITGGSGQNPARQTLIYADIPQEV 80 
51473904    1 MTQQVYITHAKRTAFGSFMGSLSTTPAPMLAAHLINNILQDSKIEPALVNEVILGQVITGGSGQNPARQTLIYAGIPQEV 80 
157826187   1 MIKPVYITYAKRTAFGSFMGSLSTTSAPMLAAPLIKDMIQNSKIDPALVGEVILGQVITGGSGQNPARQTLIHAGIPKEV 80 
91204954    1 -------MQKERLSVLLWVVLVLLTPAPMIATHLIKDILQNSKIDPALVNEVILGQVITGGSGQNPARQTLIHAGIPKEV 73 
157827716   1 MIKPVYITHAKRTAFGSFMGSLSTTPAPMIATHLIKDILQNSKIDPALVNEVILGQVITGGSGQNPARQTLIHAGIPKEV 80 
229587093   1 ---------MQRTTFGSFMGSLSTTAAPMLAAHLINDILQNSKIDPALVGEVILGQVITGGSEQNPARQTLIYAGIPKEV 71 
67458555    1 MTKPVYITHAKRTAFGSFMGSLSTTAAPMLAAHLIKDILQNSKIDPALVNEIILGQVITGGSGQNPARQTLIHAGIPKEV 80 
15604571   81 PGYTINKVCGSGLKSIALAANSIITCDNEIVIAGGQENMSLGMHGSYIRAGSKFGDIKMVDLMQYDGLIDVFSGVFMGIT 160
51473904   81 PGYTINKVCGSGLKSIALAANSIMTCDNEIVIAGGQENMSLGMHGSYIRAGAKFGDIKMVDLMQYDGLIDVFSGVFMGIT 160
157826187  81 PGYTINKVCGSGLKSVALAANAIMTGDNEIVIAGGQENMSLSMHGSYIRAGAKFGDIKMVDLMQYDGLTDVFSGVFMGIT 160
91204954   74 PGYTINKVCGSGLKTVALAAASIMTGDNDIVIAGGQENMSLGMHGSYIRAGAKFGDIKMVDLMQYDGLTDVFSGVFMGIT 153
157827716  81 PGYTINKVCGSGLKTVALAAASIMTGDNDIVIAGGQENMSLGMHGSYIRAGAKFGDIKMVDLMQYDGLTDVFSGVFMGIT 160
229587093  72 PGYTINKVCGSGLKSVVLAANSIMMDDNEIVIAGGRENMSLCMHGSYIRAGAKFGDIKMVDLMQYDGLTDVFSGVFMGIT 151
67458555   81 PGYTINKVCGSGLKSVALAANSIMIGDNEIVIAGGQENMSLGMHGSYIRAGAKFGDIKMVDLMQYDGLTDVFSGVFMGIT 160
15604571  161 AENIAKQFNISRQEQDAFALSSHKKAAKAQLSGILQDEILPIEVTVKKNTSLFDHDETVRHNTSIEILSKLRPAFDKNGV 240
51473904  161 AENIAKQFNISRQEQDEFALSSHKKAAKAQLLGILQDEILPIEVTVKKTTSLFDHDETVRHDTSIEMLSKLRPAFDKNGV 240
157826187 161 AENVSKQFNISRQEQDEFALSSHKKAAKAQLAGIFKDEILPIEVTVKKTTSLFKHDETIRPDTSLEILSKLCPAFDKNGV 240
91204954  154 AENISKQFNITREQQDEFALSSHQKAAKAQKAGIFKDEILPVEVTIKKTTSLFDHDETVRPDTSLEILGKLRPAFDKNGT 233
157827716 161 AENISKQFNITREQQDEFALSSHQKAAKAQKAGIFKDEILPVEVTIKKTTSLFDHDETVRPDTSLEILGKLRPAFDKNGT 240
229587093 152 AENISKQFNISRQQQDEFALSSHKKAAKAQLAGVFKDEILPVEVTIKKTTSLFDHDETVRPDISLEILSKLRPAFDKNVV 231
67458555  161 AENISKQFNISRQEQDEFALSSHKKAAKAQLAGIFKDEILPIEVTIKKTTSLFEHDETVRPDTSLEILSKLRPAFDKNGV 240
15604571  241 VTAGNSSSINDGAACVLLVSEKALKKHNLTPLARIVSWASAGVDPRIMGTAPVPASKKALSKAGWSVNDLEVIEVNEAFA 320
51473904  241 VTAGNASSINDGAACVLLVSEKALKKHNLTPLARIVSCASAGVDPRIMGTAPVPASKKALSKAGWSVNDLEVIEVNEAFA 320
157826187 241 VTAGNASSINDGAACLMVVSEEALKKHNLMPLARIVSYASAGVDPSIMCTAPVPASQKALSKAGWSVNDLEIIEVNEAFA 320
91204954  234 VTAGNASSINDGAACLMVVSEEALKKHNLTPLARIVSYASAGVDPSIMGTAPVPASQKALSKAGWSINDLDLIEVNEAFA 313
157827716 241 VTAGNASSINDGAACLMVVSEEALKKHNLTPLARIVSYASAGVDPSIMGTAPVPASQKALSKAGWSINDLDLIEVNEAFA 320
229587093 232 VTADNASSINDGAACLMVVSEEVLKKHNLTPLARIVSYASAGVDPSIMGTAPVPASKKALSKAGWSVNDLEVIEVNEAFA 311
67458555  241 VTAGNASSINDGAACLMVVSEEALKKHNLMPLARIVSYASAGVDPSIMGTAPVPASQKALSKAGWSVNDLEVIEVNEAFA 320
15604571  321 AQSIYVNREMKWDIEKVNINGGAIAIGHPIGASGGRLLITLIHNLRRAKAKKGLVTLCIGGGIGISMCVEAV 392
51473904  321 AQSIYVNREMKWDIEKVNINGGAIAIGHPIGASGGRILITLIHNLRRAKAKKGLVTLCIGGGLGMSMCVEAV 392
157826187 321 AQSIYVNREMKWDMDKVNINGGAIAIGHPIGASGGRILITLIHSLRRAKAKKGLVTLCIGGGIGMAMCVEAV 392
91204954  314 SQSIYVNREMKWDMNKVNVNGGAIAIGHPIGASGGRVLVTLIHGLRRNKAKKGLVTLCIGGGMGMAMCVETI 385
157827716 321 SQSIYVNREMKWDMNKVNVNGGAIAIGHPIGASGGRVLVTLIHGLRRNKAKKGLVTLCIGGGMGMAMCVETI 392
229587093 312 AQSIYVNREMKWDMEKVNVNGGAIAIGHPIGASGGRVLITLIHGLRRAKAKKGLVTLCIGGGMGMAMCVEAV 383
67458555  321 AQSIYVNREMKWDMDKVNINGGAIAIGHPIGASGGRVLITLIHSLRRAKAKKGLVTLCIGGGMGMAMCVESV 392
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap