Conserved Protein Domain Family
PRK06519

?
PRK06519: PRK06519 
3-oxoacyl-(acyl carrier protein) synthase II; Reviewed
Statistics
?
PSSM-Id: 235819
View PSSM: PRK06519
Aligned: 53 rows
Threshold Bit Score: 480.605
Threshold Setting Gi: 170742964
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
300022089   3 NGDEREQVWITGIGLISSLGVGIDEHWNKLHGETPprPVIDEGRFAPYTVHPMPEIDVAQQIPRTSDQRQMDRWQKFGVY 82 
170751402   1 ---MSRPVVVTGLGLVSCAGEGVDAHLAALAGEAA--PRTDSETFAPYPVHPAPAIAWDGQIPKRSDQRQMEAWQRLGVY 75 
218532883   7 RDVQARDVVVTGIGLVSCAGEGIETHLNAFASNAP--PRTDAETFAPYPVHPVAPVSLDAQIPKKSDQRQMEAWQRLGVY 84 
170742964   1 --MSPRDVVVTGLGLVSCAGEGVAAHLAALAAGAR--PRTDAESFAPWPVHPVAPLALDGQIPKKADQRQMEPWQRLGVY 76 
240141396   2 SRPQARDVVITGIGLVSCAGEGIETHLNAFASHAP--PRTDAETFAPYPVHPVAPVSLDAQIPKKSDQRQMEAWQRLGVY 79 
163853942   7 RDVQTRDVVITGIGLVSCAGEGIETHLNAFASQAP--PRTDAETFAPYPVHPVAPVSLDAQIPKKSDQRQMEAWQRLGVY 84 
254563912   2 SRPQARDVVVTGIGLVSCAGEGIETHLNAFASHAP--PRTDAETFAPYPVHPVAPVSLDAQIPKKSDQRQMEAWQRLGVY 79 
220921858   1 --MSAREVVITGLGLVSGAGEGVAAHQAALAAGRP--PRKDAETFAPWPVHPVAPLALDSQIPKKADQRQMEPWQRLGVY 76 
90423612    7 NATQPVEAWITGIGLASSLTEGLDAHWEALNARRV---NVDTQSLAPYVVHPLAPISFDRQIPKKGDQRQMEAWQRIGTY 83 
209885620   3 DKTTAREVWITGIGLASSLGEGLDEHWDALQARRI---NVDETTFAPYPVHPIVKLNYDAQIPKKGDLRQMESWQRIGTY 79 
300022089  83 AAGLALQDAGIAGNDALLDKTDLCIAAGNGERDIALDSRILATADADGDAASRLNTELMTGLRPTLYLVQLSNLLAGNIS 162
170751402  76 AAGLALDEAGVKDDAAFKQALHLVVAAGGGERDYAADGAILTGLRDAADPGAYLNERLQNDLRPTLFLAQLSNLLAGNIA 155
218532883  85 AAGLALDSAGVKEDAGFKSALPLVVAAGGGERDYAVDGAILTGLRGTNDPGAFLNERLLNDLRPTLFLAQLSNLLAGNIS 164
170742964  77 AAGLALDAAGLKGDAARKGALHLIVAAGGGERDYAADGQILTGLRDAADPGAYLNERLQNDLRPTLFLAQLSNLLAGNIA 156
240141396  80 AAGLALDSAGVKEDAGFKSALPLVVAAGGGERDYAVDGAILTGLRGTNDPGAFLNERLLNDLRPTLFLAQLSNLLAGNIS 159
163853942  85 AAGLALDSAGVKDDAGFKSALPLVVAAGGGERDYAVDGAILTGLRGTNDPGAFLNERLLNDLRPTLFLAQLSNLLAGNIS 164
254563912  80 AAGLALDSAGVKEDAGFKSALPLVVAAGGGERDYAVDGAILTGLRGTNDPGAFLNERLLNDLRPTLFLAQLSNLLAGNIS 159
220921858  77 AAGLALDAAGLKGDAARKGAMHLIVAAGGGERDYAVDGQILTGLRAAADPGAFLNERLQNDLRPTLFLAQLSNLLAGNIA 156
90423612   84 AAGLALESAGLKGNKDILSKMDMIVAAGGGERDLAVDSAILNAEAQGNTPPGFLNERLMNDLRPTLFLAQLSNLLAGNIA 163
209885620  80 AAGLALEGAGLKGNTDILSRMDMIVAAGGGERDLAVDATVLNDQAQGNAAPGALNERLMGGLRPTLFLAQLSNLLAGNIS 159
300022089 163 IIHKATGSSRTFKGEEMAGVSAIKNAVDRIKAGQGDLFLVGGALNAEREDFLLGCELTGGLYHGPHKSVWDRQGe---ND 239
170751402 156 IVHGVTGASRTFMGEESAGVDALRIAQARVASGQIDAILVGGSYSAERPDVLVIHEMGGYLARDAYRPVFARGDaggeAG 235
218532883 165 IVHGVTGASRTFMGEESSGVDALRIGHARIASGQVETMMVGGSYNAERPDVMVVHEMGGYLLKTAYRPVFERGAe--gTG 242
170742964 157 IVHGVTGASRTFMGEESSGVDALRIAGARIAAGQVDSVLVGGSYNAERADVLLVHEMGGYLYRPDYAPVFRREG----RG 232
240141396 160 IVHGVTGASRTFMGEESSGVDALRIGHARIASGQVDTMMVGGSYNAERPDVMVVHEMGGYLLKTAYRPVFERGAe--gTG 237
163853942 165 IVHGVTGASRTFMGEESSGVDALRIGHARIASGQVETMMVGGSYNAERPDVMVVHEMGGYLLKTAYRPVFERGAe--gTG 242
254563912 160 IVHGVTGASRTFMGEESSGVDALRIGHARIASGQVDTMMVGGSYNAERPDVMVVHEMGGYLLKTAYRPVFERGAe--gTG 237
220921858 157 IVHGVTGASRTFMGEESSGVDALRIAQARIAAGQVDSMLVGGSYNAERADVLLVHEMGGFLYRPDYAPVFRREG----TG 232
90423612  164 IVHGVTGSSRTFMGEEPAGIDAARIALARIAAGQSDIALIGAAQNGERKDLLMLYEFGDFSLKDAYTPVWQREP----KG 239
209885620 160 IVHGVTGSSRTFMGEEAAGTDAFRIALARIVSGQSDIALVGAAHNGERKDLLMLYEFGDFALKGKATPVWARNGe---AT 236
300022089 240 GFIPGSVGVFLVLESSSHAKARGAMPYAQIAGIASDRSPR-APGDIAATASTLLKELPldtSNRELfVMSGASGVRATTA 318
170751402 236 GFILGSCAAFLMLESAAHAAARGARALARLEPVASDRTRR-VPGSVAGSLETLWRRAGl--SAPDH-VLSGATGVAPITA 311
218532883 243 GFVLGSAAAFLVLEAAEHAAARGAKALARLMPVANDRVAR-APGSVSASLTRLIGEAGi--ERPDV-VLSGATGLADLAA 318
170742964 233 GFILGSGAAFLVLEAAETAAARGAAPLARLAAVASDRTRR-APGSVAASLTALWREAGl--EAPDA-VISGATGCAGITR 308
240141396 238 GFVLGSAAAFLVLEAAEHAAARGAKALARLMPVANDRVAR-APGSVSASLTRLIGEAGi--ERPDV-VLSGATGLADLAA 313
163853942 243 GFVLGSAAAFLVLEAAEHAATRGARALARLMPVANDRVAR-APGSVSASLTRLIGEAGi--ERPDV-VLSGATGLTDLAA 318
254563912 238 GFVLGSAAAFLVLEAAEHAAARGARALARLMPVANDRVAR-TPGSVSASLTRLIGEAGi--ERPDV-VLSGATGLADLAA 313
220921858 233 GFILGSGAAFLVLESADHAAARRAAPLARLAAVASDRSRR-APGSVGASLTALWRQAGl--ADPDA-VISGATGCAGITG 308
90423612  240 GFALGSGGAFLVIESRAHAEARGAKPFARLGSVVADLAPRkQPGEVTATLQKLWSRLGpvqAGAAA-IITGATGAEPVTS 318
209885620 237 GFALGSGGVFLVIESKEHAQARGAKPFARLSQVVADHARRtVPGNVTAVLDALWAKLGvptDTP---IITGATGAAYPTD 313
300022089 319 EELQFLSNVQKAgiepvIRAWGSIFGHTHEAHFLVGIALAALALSKSEFYPPFDTSGvEHTRKTWADQILVTTFGHWRGE 398
170751402 312 EERAALAQLAPRa---rLRALGDVIGHGLEVAAPFGAALAAALVADGR-----------------AREVAVTAVGHRRGE 371
218532883 319 EEIAGLHAALPGa---rIRATGDMIGHPMEVAAPFGAALAAALCAAGS-----------------AAEVAVTSVGHRRGE 378
170742964 309 EEAERLADLAPGa---rVSALGDLTGHTLEATAPFGAALAAALVARGA-----------------AREVAVTAVGHRRGE 368
240141396 314 EEIAGLDAALPGa---rIRATGDMIGHPMEVAAPFGAALAAALCAAGS-----------------AAEVAVTSVGHRRGE 373
163853942 319 EELAGLHAALPGa---rIRATGDMIGHPMEVAAPFGAALAAALCAAGS-----------------AAEVAVTSVGHRRGE 378
254563912 314 EEIAGLDAALPGa---rIRATGDMIGHPMEVAAPFGAALAAALCAAGS-----------------AAEVAVTSVGHRRGE 373
220921858 309 EEAATLATLAPGa---rVSALGDLTGHTLEVTAPFGAALAAALVASGA-----------------AREVAVTAVGHRRGE 368
90423612  319 EERAFLRQHAELp----VRASGSSFGHIMEAQFPLGIALAALSISRGALFAPNDPTGfEREMSGAPNQIVVIGTGHCRGE 394
209885620 314 EERAFLKKHANAp----VRGHATSFGHLMEAQLPLGLALAALSIAKGKLFAANDSTGvEIESAASPSQIVVIGIGHWRGE 389
300022089 399 GLGLVQSVW 407
170751402 372 GVLRLVPA- 379
218532883 379 GVIRVVRI- 386
170742964 369 GVLRILPAR 377
240141396 374 GVIRVVRI- 381
163853942 379 GVIRVVRI- 386
254563912 374 GVIRVVRI- 381
220921858 369 GVLRILPAG 377
90423612  395 GMALVESIS 403
209885620 390 GMALVERVP 398
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap