Conserved Protein Domain Family
PRK06504

?
PRK06504: PRK06504 
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 180595
View PSSM: PRK06504
Aligned: 27 rows
Threshold Bit Score: 696.092
Threshold Setting Gi: 50084731
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
160900249   1 MAQAYIVAATRTAGGKRGGKLSGWHPADLAAQVLDELVRRSQADPAQVEDVIMGCVSQVGQQATNVARNAVLASS-LPES 79 
197105965   1 MAEAYIVAATRTAGGRKGGRVRGWHPADLGAVVLNELMDRTGVDPAAVEDVVMGCVMQVGEQSTNIARNAVLASK-LPES 79 
50084731    1 MNVAYIVDAVRTAGGRRNGKLASWHPVDLGAEVINALLDRTGIDPNVIDDAVFGCVTQAGEQTFAFARNIVLASK-LPIH 79 
85373122    3 MTTAYIVEAVRTAGGRRGGRLAGVHPVDLLAKSLDAVVERSGVDPAAIDDVVTGCVSQAGEQAMQVGRMGVLASKhLPQS 82 
239813464   1 MAEAYIVAAARTAGGRRGGKLAGWHPADLAAQVIDALVARSGIDPAAVEDVILGCVSQVGEQATNVARNAVLASR-LPES 79 
94314351    1 MSEAYIVSAVRTAGGRRNGRLSGWHPADLAGQVLDALVERSGADPSMVEDVIMGCVGQAGEQSSNIARGAVLASK-LPES 79 
294146815   1 MVEAYIVAAARTAGGRRGGKLAGWHPADLAGKLLDALVDRAGADPAIVDDVIMGCVGQASEQSTNIGRSAVLSSK-LPES 79 
87199091    1 MATAYIVDAVRTAGGRRGGRLAGVHPVDLAARSLDAIVARTGIDPTAVDDVIMGCVTQAGQQAMQVGRNAVLASKlLPQS 80 
103488633   1 MATAYIVDAVRTAGGKRGGKLAGVHPVDLGAAVFDAIAARNDFDTSKIDDVITGCVSQGGQQTMDLGRNAVLASN-LPDS 79 
154251997   1 MAEAYIVAAARTAGGRKGGKLKDWHPADMGGKVIDELVKRTGADPELIEDVIVGCVDQAGEQGMNIARNAVLASG-LPES 79 
160900249  80 VPGTTVDRQCGSSQQALHFAAQAVMSGSMDMVIAAGVESMSRVPMGTPNALPAKAGL-GVYMSPAMQQRYPGVEFSQFMG 158
197105965  80 VPATSVDRQCGSSQQALQFAAQAVMSGTMDVVIASGVESMTRVPMGLSVSLAAKEGF-GVPKSPRMEERYPNIQFSQFMG 158
50084731   80 VPGVTIDRQCGSSQQAVQFAAQAILSGMQDVVIAGGVESMSRAPMLSNASLHAKAGLpADPLSPRIKARFDVDQFSQFTG 159
85373122   83 TPAVTIDRQCGSSQQAIQFAAQAVMSGTQDAVIASGVESMSRVPMGSNATFHMKEGL-GHYKSPGLEEKYPKVQFSQFMG 161
239813464  80 VPGTSVDRQCGSSQQALHFAAQAVMSGAMDAVIAGGVESMTRVPMFTPNALPAKAGL-GTYMSPAMKRRYPGVEFSQFTG 158
94314351   80 VPATSVDRQCGSSQQALHFAAQAVMSGTMDVVIAAGVESMSRVPMGTPSTLPRKNGL-GHYVSPQMQARYPGVEFSQFTG 158
294146815  80 VPGTSVDRQCGSSQQALHFAAQAVMSGTMDVVIAAGVESMTRVPMGTASNGP---GF-GSWSGEEMKARYPGIVFNQFDG 155
87199091   81 TPAVTIDRQCGSSQQAIQFAAQAVMSGVQDMVIAAGVESMSRVPMGSNATFHMKEGL-GHYKSPGLEEKYPGVMFSQFMG 159
103488633  80 IPAVTIDRQCGSSQQAMMFAAQAVMSGTQDIVLASGIESMTRVPMGSVATLFIKEGL-GHYKSERLEEKYPGIMFSQFMG 158
154251997  80 VPATSVDRQCGSSQQALHFGAQAVMSGAMDVVIAAGIESMTRVPMGMPISLPFKNGF-GIYKSPNIEERYPNIQFSQFAG 158
160900249 159 AEMMAGKYGLAKDQLDAYALQSHERAVQAAREGRFDREILAVQARSAEGgaegEGQPHTVDEGIRFNATLEGIAGVKTIR 238
197105965 159 AEMVAEKYGLTKDQLDEFGYQSHQRAIAATQGGAFKDEIVAIDGLDAEG----NTVRHDVDEGIRFDVSLDGMKGVKLLR 234
50084731  160 AEMMAKKYGFDREQLDQYALLSHQRAIQATETGNFENEIVVLDV---------DGEAHRIDEGIRFDANLESVSGLKPLV 230
85373122  162 AEMIANKHGFDKDQLDSFALGSHAKAIKATETGAFKAEIVPVEVETPEG-----EQMHTVDEGIRFDATLDGIAGVKLIS 236
239813464 159 AEMIAKNYGIDKDALDRYALESHRRAMAATRSGAFEGEIVPIEILQADGs--gTGEQHMVDEGIRVDATLEGIAGVKLIA 236
94314351  159 AEMIAKKYKLDKTALDAYALRSHQLAAAATKAGRFEQEILPLAARMNDGs--dLGEFHTIDEGIRFDATLEGIASVKLIA 236
294146815 156 AAMIAKKYGHSRDQLDQFGYESHRKAIAAVEAGAFDAEIVPIPVEGPDG----EAALHVRDEGIRFDVTREAMAGVKLLA 231
87199091  160 AEMIVKKHGFTKDDLDRFSLDSHRKAIAATNAQAFANEIVPVEIETPEG-----PAMHTVDEGIRFDATLEGIAGVKLLS 234
103488633 159 AEMIVQKHGFTKDDLDAFALESHRRAKAATEAGKFEREIVPIEIETPEG-----RELHKVDEGIRFDATLEGIAGVKLLQ 233
154251997 159 AEMMAKKYGLTKDQLDEFAYNSHQKAIAATQAGLFDEEIVPLEIALEDG----SKDMHKVDEGIRFDANLEAIKNVKLLV 234
160900249 239 EGGCVTAATASQICDGASGVMVVSERGLKALGVQPLARIHHMSLLGHDPVIMLEAPIPATQAALKKAGMRISDIDLYEVN 318
197105965 235 EGGRITAATSSQICDGASGVMIVSEKALKEHNLTPMARIHHLSILGHDPVIMLEAPIPATERALKKAGMSVDDIDLYEVN 314
50084731  231 ENGVVTAANASQICDGASAVLIVSERALKAYDLTPKARLIHMSVSAGDPVMMLEEPIFATQKALKKAGLKITDIDLYEVN 310
85373122  237 TEGKITAATSSQICDGSSAVLVVSEEFLKTHNLTPLARIHNLTVTAGDPVIMLEEPLFATDKALERAGMKIDDIDLYEVN 316
239813464 237 EGGRCTAATASQICDGASGVLVVNERGLKALGVKPIARIHHMSVMGHDPVIMLEAPLPATLRALKKAGMRIQDIDLYEVN 316
94314351  237 EGGSVTAATASQICDGASGVMVVNERGLKMLGVKPLARIHHMSVLGHDPVVMLEAPLPATERALKRAGMRIDDIDLYEVN 316
294146815 232 EGGIITAATSSQICDGASGVMVVNERGLKGLGVEPLARIHHMSVRGGDPVIMLEAPLEATSHALRKAGMSIDDIDLFEVN 311
87199091  235 PEGSLTAASSSQICDGSSAVLVVSEAALKAHGLTPLARIHNLTVTAGDPVIMLEEPLFATDRALQRAGMKISDIDLYEVN 314
103488633 234 EGGAITAATSSQICDGASAVLIVSEQALKDHGLTPRARIHHVSVTAGDPVIMLEEPLFATEKALKRAGMTIADIDAYEVN 313
154251997 235 EGGAITAASSSQICDGASGVMIVNEKGLKALGVEPLARIHHMTVVGGDPVIMLEAPIPGTEKALKKAGMKIEDIDLYEVN 314
160900249 319 EAFAPVPLAWLQATGADPARLNVNGGAIALGHPLGASGTKLMATLIHALHARGGRYGLQTMCEGGGMANVTIIERL 394
197105965 315 EAFASVPVAYLQKLGVDPERMNVNGGAIALGHPLGASGTKLMTTLLYALQKRGKKYGLQTMCEGGGMANVTIVERL 390
50084731  311 EAFAPVPLAWLQALDANPEALNIHGGAIALGHPLGASGTKLMTTLIHALHTQGKRYGLQTMCEGGGMANVTILEAC 386
85373122  317 EAFAPVPLAWLKHTGADPDKLNVHGGAIALGHPLGASGTKLMATLVHALKRHDKKYGLQTMCEGGGVANVTIVEAV 392
239813464 317 EAFAPVPIAWLEALDADPARLNVNGGAIALGHPLGASGTKLMTTLVHALGRRGKRYGLQTMCEGGGMANVTIVERL 392
94314351  317 EAFAPVPLAWLQALGADADRLNVNGGAIALGHPLGGSGTKLMTTLIHALHQRGKRYGLQTMCEGGGMANVTIVERL 392
294146815 312 EAFAPIPLAWLSHCGADPKRLNVNGGAIALGHPLGASGTKLMTTLIHALRARGKRYGLQTMCEGGGMANVTIVERL 387
87199091  315 EAFASVPMAWLKHTGADPEKLNVNGGAIALGHPLGASGSKLMATLVHALRARGGKYGLQTMCEGGGVANVTIIEAL 390
103488633 314 EAFAPVPLAWMKYLGADHARLNQHGGAIALGHPLGASGTKLMATLLGVLDATGGRYGLQTMCEGGGQANVTIVERL 389
154251997 315 EAFASVPAAWLQVLGADPARLNVNGGAISLGHPLGASGTKLMTTLVHALKNKKKRYGLQTMCEGGGLANVTIVERL 390
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap