Conserved Protein Domain Family
PRK06501

?
PRK06501: PRK06501 
3-oxoacyl-(acyl carrier protein) synthase II; Reviewed
Statistics
?
PSSM-Id: 235817
View PSSM: PRK06501
Aligned: 54 rows
Threshold Bit Score: 732.588
Threshold Setting Gi: 170742965
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
222148500   7 ESRFKDHLGRPIIAVTGMGVITSLGQGLADNWAKLTGGVSGIHKITRFPTEGLNTRISGTVDFIDIPAINAVERSYAMAR 86 
300022085   1 MSQGHDKKGRPLVAVTGMGVVTSLGNGKADNWAALTQGRSGIRSITRFPTDGLRTTIAGTVDTLKVSPYSAPSLSIAMAL 80 
170749475   3 ARSYRDARGRPLVAVTGLGVVSSLGQGQADTWAAMTEGRSGIHTIARFPTDNLRTRIAGTVDFLDTDPLVAPLLSERFAA 82 
218532882   6 SSSTHDALGRPLVAVTGLGIVTSLGRGATENWDALTTGRSGIRAISRFPTEGLRTRIAGTVDFLDTDPLVAPLLSERFAM 85 
170742965   1 MSAYRDAKGRPLVAVTGLGVVTSLGRGVAENWAALTAGRSGIHAITRFPTDGLRTRIAGTVDFLAAEPMVAPVLSEALAA 80 
240141395   6 SSSTHDALGRPLVAVTGLGIVTSLGRGATENWDALTTGRSGIRAISRFPTEGLRTRIAGTVDFLDTDPLVAPLLSERFAM 85 
163853941   6 SSSTHDALGRPLVAVTGLGIVTSLGRGATENWDALTTGRSGIRAISRFPTEGLRTRIAGTVDFLDTDPLVAPLLSERFAM 85 
254563911   6 SSSTHDALGRPLVAVTGLGIVTSLGRGATENWDALTTGRSGIRAISRFPTEGLRTRIAGTVDFLDTDPLVAPLLSERFAM 85 
220921857   2 MRAYRDAKGRPLVAVTGMGVVTSLGQGVAENWSALTAGRSGIHAITRFPTEGLRTRIAGTVDFLKAEPMVAPLLSERLAA 81 
188584244   6 SSSTHDAQGRPLVAVTGLGIVTSLGRGVAENWDALTAGRSGIRAISRFPTEGLRTRIAGTVDFLDTDPLVAPLLSERFAM 85 
222148500  87 ETTIEALAQAGL--SGDFEGPLFLAAPPVEPEWDDRFALAERAPAETAEghaYQRLLAAMRAEADPVFLEAVQFGSISER 164
300022085  81 EAANEALHEAQAgsNGKFPGPLFLATPPAELEWPQRRALYQSALDKNESg--YRRLLASARASDWDEMQSLFQFSSVANH 158
170749475  83 VAAEEAVAQAGIgaRGDFPGALFIAVPPVEMEWPQRQALAEAAGGDGPVd--YAGLLRAAATRRFDPWHDLFIFGTVADR 160
218532882  86 VAAEEAVTQSGI--GAGFPGGLFVAVPPVEMEWPQRQALADAAGEPDAVt--YAGLQRAAASRRFDAWHDLFIFGTVADR 161
170742965  81 AAAEEAVAEAGL--PGDFPGALFIAVPPVEMEWPQRQALAAQATGEVT----YADLLRAAATRRFDDWHDLFIFGTVADR 154
240141395  86 VAAEEAVTQSGI--GAGFPGGLFVAVPPVEMEWPQRQALAEAAGEPDAVt--YAGLQRAAASRRFDAWHDLFIFGTVADR 161
163853941  86 VAAEEAVTQSGI--GAGFPGGLFVAVPPVEMEWPQRQALAEAAGEPDAVt--YAGLQRAAASRRFDAWHDLFIFGTVADR 161
254563911  86 VAAEEAVTQSGI--GAGFPGGLFVAVPPVEMEWPQRQALAEAAGEPDAVt--YAGLQRAAASRRFDAWHDLFIFGTVADR 161
220921857  82 AAAEEAVAEARI--PGDFPGALFIAVPPVEMEWPQRQALAEAAGVSGDIt--YADLLRAASTRRFDDWHDLFIFGTVADR 157
188584244  86 VVAEEAVTQAGI--GAGFPGGLFVAVPPVEMEWPQRQALAEAAGEPEAVt--YAGLQQAAATRRFDAWHDLFIFGTVADR 161
222148500 165 LADRFGTRGLPVTLSTACASGATAIQLGVEAIRQGRTDRALTVATDGSVGAEALIRFALLSALSTQNDPPEKASKPFSKD 244
300022085 159 VAERLGTRGLPTSVSTACASGATAIQLGVEAIRRGETDAALCIGTDSSVQIEALIRFSLLSALSTNNAAPEQASRPFSKN 238
170749475 161 IADRFGTKGSPISLSTACSSGATAIQLGVEAIRRGETAAALCIGTDGSVNPESLIRFSLLSALSTRNDDPATASKPFSKD 240
218532882 162 LADRFGTRGSPISLSTACSSGATAIQLGVEAIRRGEMDAALCIGTDGSVNPESLIRFSLLSALSTQNDPPEGASKPFSKN 241
170742965 155 IADRFGTRGSPISLSTACSSGATAIQLGVEAIRRGEMRAALCIGTDGSVNPESLIRFSLLSALSTQNDPPEAAAKPFAKN 234
240141395 162 LADRFGTRGSPISLSTACSSGATAIQLGVEAIRRGEMDAALCIGTDGSVNPESLIRFSLLSALSTQNDPPEGASKPFSKN 241
163853941 162 LADRFGTRGSPISLSTACSSGATAIQLGVEAIRRGEMDAALCIGTDGSVNPESLIRFSLLSALSTQNDPPEGASKPFSKN 241
254563911 162 LADRFGTRGSPISLSTACSSGATAIQLGVEAIRRGEMDAALCIGTDGSVNPESLIRFSLLSALSTQNDPPEGASKPFSKN 241
220921857 158 IADRFGTKGSPISLSTACSSGATAIQLGVEAIRRGEMTAALCIGTDGSVNPESLIRFSLLSALSTQNDPPEAASKPFARN 237
188584244 162 LADRFGTRGSPISLSTACSSGATAIQLGVEAIRRGEMDAALCIGTDGSVNPESLIRFSLLSALSTQNDPPEGASKPFSKN 241
222148500 245 RDGFVIAEGAATLVLESLEAAIARGAKVLGIMKGCGEKADHFHRTRSSPDGGPAIATIRAALEDAGLSDDGIGYINAHGT 324
300022085 239 RDGFVMAEGAGALVLESYEGAKRRGARILGFVRGCGEKADDYHRTRSKPDGTAIIGAIRNAIDDACLSPDDIDYVNAHGT 318
170749475 241 RDGFVMGEGAAALVLEDAEAAVARGAAILGYVLGCGEKGDGFHRTRSSPDGAPIIAAIRASLDDAGVAAEAIDTVNAHGT 320
218532882 242 RDGFVMGEGAAALVLESAESARARGAKILGYVLGCGEKGDGFHRTRSSPDGAPVIAAMRAALDDAGVTPEAIDHVNAHGT 321
170742965 235 RDGFVMGEGAAALVLEEAEAAAARGARILGYVLGCGEKGDGFHRTRSSPDGAPIIAAIREAIADAGLDPDRIDTVNAHGT 314
240141395 242 RDGFVMGEGAAALVLESAESARARGAKILGYVLGCGEKGDGFHRTRSSPDGAPVIAAMRAALDDASVTPEAIDHVNAHGT 321
163853941 242 RDGFVMGEGAAALVLESAESARARGAKILGYVLGCGEKGDGFHRTRSSPDGAPVIAAMRAALDDAGVTPEAIDHVNAHGT 321
254563911 242 RDGFVMGEGAAALVLESAESARARGAKILGYVLGCGEKGDGFHRTRSSPDGAPVIAAMRAALDDAGVTPEAIDHVNAHGT 321
220921857 238 RDGFVMGEGAAALVLEDAAAASARGARILGYVLGCGEKGDGFHRTRSSPDGAPIIAAIQDALDDAGLAPDEIDTVNAHGT 317
188584244 242 RDGFVMGEGAAALVLESAESARSRGAKILGYVLGCGEKGDGFHRTRSSPDGAPVIAAMRAALDDAGVAPEAIDHVNAHGT 321
222148500 325 STPENDKMEYGAMLSVFGERLKDqIPVSSNKSMIGHTLTAAGAVEAVFSIQTMLTGTLPPTINYTNPDPTVELDVVPNVK 404
300022085 319 STPENDKMEYLSLKAVIGDRVAN-VPMSSNKSMIGHTLSAAGAIEAVFSLLTIRNGTLPPTINYAVPDAEIPMDVVPNVA 397
170749475 321 STPENDKMEALGLAAVFGDRAAA-LPVTSNKSMIGHTLTAAGAIEAAVSLLTIRHGRIPPTINHRVPDPTIALDIV-ETA 398
218532882 322 STPENDKMEALGCSAVFGERVAR-LPISSNKSMIGHTLTAAGAIEAVVSLLTIQKGRIPPTINYAVPDPALLLDVV-GTA 399
170742965 315 GTPENDKMEALGCLAVMGERMRS-VPISSNKSMIGHTLTAAGAVEAVVSLLTLRHGRVPPTLNYALPDPAIPLDVV-TRA 392
240141395 322 STPENDKMEALGCSAVFGERVAR-LPISSNKSMIGHTLTAAGAIEAVVSLLTIQKGRIPPTINYAVPDPALLLDVV-GTA 399
163853941 322 STPENDKMEALGCSAVFGERVAR-LPISSNKSMIGHTLTAAGAIEAVVSLLTIQKGRIPPTINYAVPDPALVLDVV-GTA 399
254563911 322 STPENDKMEALGCSAVFGERVAR-LPISSNKSMIGHTLTAAGAIEAVVSLLTIQKGRIPPTINYAVPDPALVLDVV-GTA 399
220921857 318 GTPENDKMEALGCLAVLGERMRS-VPISSNKSMIGHTLTAAGAIEAAFSLLTIATGRVPPTLNYAVPDPAIPLDVV-TAA 395
188584244 322 STPENDKMEALGCSAVFGERIGS-LPISSNKSMIGHTLTAAGAIEAVVSLLTIRHGRIPPTINYALPDPALLLDVV-GTA 399
222148500 405 RDAQVSAVLSNSFGFGGQNASLVMTLEPA 433
300022085 398 RQARVQAVLSNSFGFGGQNAALVITAP-- 424
170749475 399 RDLPVRTVLSNSFGFGGQNTCLVLGAEPA 427
218532882 400 RDTRVSRILSNSFGFGGQNTCLVLGDEPA 428
170742965 393 RDLPVRTVLSNSFGFGGQNTCLVFGAEPA 421
240141395 400 RDTRVSRILSNSFGFGGQNTCLVLGDEPA 428
163853941 400 RDTRVSRILSNSFGFGGQNTCLVLGDEPA 428
254563911 400 RDTRVSRILSNSFGFGGQNTCLVLGDEPA 428
220921857 396 RDLPVRTVLSNSFGFGGQNTCLVLAAEPA 424
188584244 400 RDARVARVLSNSFGFGGQNTCLVLGDEPA 428
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap