Conserved Protein Domain Family
PRK06445

?
PRK06445: PRK06445 
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 180563
View PSSM: PRK06445
Aligned: 19 rows
Threshold Bit Score: 695.7
Threshold Setting Gi: 302341532
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11499825    1 MEEVYIVDFLRSAFSRSRPKQPEKDVFNKIDMPAVAAMLIKEMVNRTGIDPKEIGDVITGCTMQMKENWLYGGKVVPLLA 80 
119871549   8 LENVYIVAFARTAFTRFSRKEPQKDDFWDVRPEELAAVPVRAILEKTGVKPEDVEDLLTGTALPVGEQWLYGGRHVVFAA 87 
145591299   8 LENVYLVAFARTAFTRFSRKDPQKDDFWDLRPEDLAAVAVKALFEKTGVKPEVVEDMLTGTALPVGEQWLYGGRHVVFAA 87 
126459263   8 LENVYLVAFARTAFTRFSRKEPQKDDFWDLRPEEIAAVPVRAILERTGVKPEAVEDLLTGTALPVGEQWLYGGRHVVFAA 87 
18314226    8 LDNVYLVAFSRTAFTRFSRKEPQRDDFWDLRPEEIAAVPVRALLEKTGVRPEDVEELLTGTALPVGEQWLYGGRHVVFAA 87 
227829335   2 LEDVYLVDYARTAFTRFSRKDYQKDPFYNIRPEELAGMVINRLIEKNGIKAEEIDEIITGCALQVGEQWAFGGRHEIFAA 81 
15899236    2 LEDVYLVDYARTAFTRFSRKDYQKDPFYNIRPEELAGMVINRLIEKNGIKAEEIDEIITGCALQVGEQWAFGGRHEIFAA 81 
16081433    3 SEKVYLVDFKRTAFSRSRPNDPERDVFNSIRMDEAMAKLINVVIDETGIKPEEINDVITGCALQMDENWTYGGRHPILLA 82 
13542135    3 NENVYLVDFKRTAFSRSRPNDPERDVFNSLRMDEAMAKLINIVIDETGIRPEEINDVITGCALQQDENWTYGGRHPILLA 82 
48478095    1 MEDAYIVYFKRVPFSRARPNDPERDMYNDLRMDDLLSRLIRKSVDDTGINPEEIGDVITGCAFQAGENWTYGGRHPVLLS 80 
11499825   81 ELPVEVPAHGVERVCNSSTTAVHHGTMEIMLGYSDIVIACGFEHMTHLPMQmDlNPHIGISPTLMSRtDLIQkYDLMTAM 160
119871549  88 KLPYTIPAAHIDRQCASSITTVAFGAMEVATGMADVVIAGGVEKMSKTPMY-E-NPHIEINPKFLTDeEYVRlYNLPIGY 165
145591299  88 KLPYTIPAAHIDRQCASSITTVGFGAMEVATGMADVVIAGGVEKMSKTPMY-E-NPHIEINPKFLADeEYVRlYNLPIGY 165
126459263  88 KLPYTIPAAHIDRQCASSITTVAMGAMEVASGMADVVIAGGVEKMSKTPMY-E-NPHIEINPKFLTDeEYVHlYNLHIGY 165
18314226   88 KLPYTIPAAHIDRQCASSITTVGYGAMEIATGMADIVIAGGVEKMSKTPMY-E-NPHIEINPKFLTDdEYVRlYNLPIGY 165
227829335  82 RLPYNIPTMAVDRQCASSLTTVSIGAMEISTGMADIVLAGGVEKLSRTPMF-D-NPHIEVNTKFLTDsKYIE-YDLTTGY 158
15899236   82 RLPYNIPTMAVDRQCASSLTTVSIGAMEISTGMADIVLAGGVEKLSRTPMF-D-NPHIEVNTKFLTDsKYIE-YDLTTGY 158
16081433   83 NLPENVPGMALDRACSSSLNAITIGAMEIMTGNSDIVMAGGYEHMTHVPMG-N-SPFLKPNIKLMVRpEYMH-WDMNTGY 159
13542135   83 NLPDNVPGMALDRACSSSLNAITIGAMEIMTGNADIVMAGGYEHMTHVPMS-N-SPFLKPNVKLLVRpEYMH-YDMNTGY 159
48478095   81 ELPVSVPAMSLDRACSSSLNAVSIGAMEIMSEKSDIVIAGGMEHMTHVPLGiS-NPYIKPNMSLMLNpRYSK-YDMNVSY 158
11499825  161 SMGLTAEKLFEVAKdemgWTKRDLDEWGVRSHKLAAQAVKEGWFlegegypmkwKGEILPIEVeQADGSKKVIDVDQSIR 240
119871549 166 VMGLTAERLAEVSG----IKREEMDMWSLRSHRRAAEAYEKGYF----------KDEIVPVAV-EKDGQRKVVDRDQSVR 230
145591299 166 VMGLTAERLAEVSG----IKREEMDAWSLRSHRKATEAQEKGYF----------RDEIIPIIV-EREGQKKVVDRDQSVR 230
126459263 166 VMGLTAERLAEVSG----IKREEMDAWSLRSHKRAAEAYEKGYF----------KEEIVPVAV-EKEGQKKVVDRDQAVR 230
18314226  166 VMGLTAERLAEISG----IKREEMDAWSLRSHKRAAEAYEKGYF----------KDEIVPVAV-EREGQRKIVDRDQSIR 230
227829335 159 VMGLTAEKLAEEAR----IKREEMDRWSLRSHQLAWKAIQEGYF----------KDEILPIEV-EVEGKKTVVNVDQSVR 223
15899236  159 VMGLTAEKLAEEAR----IKREEMDRWSLRSHQLAWKAIQEGYF----------KDEILPIEV-EVEGKKTVVNVDQSVR 223
16081433  160 SMGLTAEKLAALRG----ITRDEMDRYSLRSHQLASKALDDGYF----------KGEIVPVEV-EINGEEKVIDTDQSIR 224
13542135  160 SMGLTAEKLASLHH----IGREEMDQYALRSHQLASKALDDGYF----------KGEIVPMEV-EIGGETKIIDSDQSIR 224
48478095  159 NMGLTAEKLAALRG----ITRKEMDEYSYNSHLRARKAYESGFM----------KDEIMPVTV-ERDGEEIKIEKDLSIR 223
11499825  241 PDTTLEQVEKLPPAFKPGGVITAGNSSPLNAGATALMLMSKKKMKEYGLEPMAKIVSMGWASIDPSIMGASPVPASLKAL 320
119871549 231 PDTSLEALAKLPPVFKPDGVITAGNSSPLNSGAAYIMLVSGEVVKKHGLQPLAKIRAVAFAGVPPEVMGMGPVPASKKAL 310
145591299 231 PDTTLEALAKLPPAFKPDGVITAGNSSPLNSGAAYVMLASGEAVKKYGLQPLAKVRAVAFAGVPPEVMGMGPVPASRKAL 310
126459263 231 PDTTLEALAKLPPAFKPDGVITAGNSSPLNSGAAYVMLASGEAVKKYGLQPLAKVRAVAFAGVPPEVMGMGPVPASRKAL 310
18314226  231 PDTSLEALAKLPPAFKPDGVITAGNSSPLNSGAAYVMLASGEAVKKYGLQPMAKIRAVAFAGVPPEVMGMGPVPASRKAL 310
227829335 224 PDTSIEKLGQLPPAFKPNGTITAGNSAPLNSGASYVLLMSKNALKKYGLTPMAKIRSFGFAGVPPAVMGKGPVPASKKAL 303
15899236  224 PDTSIEKLGQLPPAFKPNGTITAGNSAPLNSGASYVLLMSKNALKKYGLTPMAKIRSFGFAGVPPAVMGKGPVPASKKAL 303
16081433  225 KNTSLEDMKKLKPAFKDDGVITAGNSSPLNAGASLTLLMSEKKVKEYGLKPMARIVSFGWAGVDPSIMGEGPVPATKNAL 304
13542135  225 KNTSLEEMQKLRPAFKDDGVITAGNSSPLNAGASLTLLMSEKKVKEYGLKPLSRIVSFGWAGVDPSIMGEGPVPATQKAL 304
48478095  224 DDASLESMEALKPAFKPDGIITAGNSAPLNDGASMVMLMSERAMNEYGLKPMARIVDFAAAGVDPTIMGDGPVPATRKIL 303
11499825  321 QKAGLEAKDIDYWEINEAFSVVPLYTIKKLGLDPERVNIKGGAIAIGHPLGASGGRVLGTLARILLVQEAKYGCATLCGA 400
119871549 311 EKAGLTVKQIGRWEINEAFAVVTLYAIKQLGLDPEIVNTRGGAIAIGHPLGATGARIIGTLARQMQIDGVDYGVATLCVG 390
145591299 311 EKAGLSVKQIGRWEINEAFAVVTLYAIRELGIDPDTVNTRGGAIAIGHPLGATGARIIGTLARQMQIDGVDYGVATLCVG 390
126459263 311 EKAGLTVKQIGRWEINEAFAVVTLYAIKELGIDPELVNTRGGAIAIGHPLGATGARIIGTLARQLQLDGVDYGVATLCVG 390
18314226  311 EKAGLTVKQIGRWEINEAFAVVTLYAIRELGIDPELVNTRGGAIAIGHPLGATGARIIGTLARQMQLDGVDYGVATLCVG 390
227829335 304 EKANLSTRKIDLWEINEAFAVVVLYAIKQLELDESTVNKKGGAIAIGHPLGATGARLVGTLARQLIIEGKDYGVATLCVG 383
15899236  304 EKANLSTRKIDLWEINEAFAVVVLYAIKQLELDESTVNKKGGAIAIGHPLGATGARLVGTLARQLIIEGKDYGVATLCVG 383
16081433  305 AKAKMDVSDIDLWEINEAFAVVVLNAMKELGIEEDRVNVHGGAIAIGHPLGATGARIAGTLARIMNEKKKDYGVATLCVG 384
13542135  305 AKAGMKVEDIDYWEINEAFAVVVLNAMKELGIEENKVNIHGGGISIGHPLGATGARIAGTLSRILNEKQAEYGVATLCVG 384
48478095  304 SRNKIDPQDIDLWEINEAFAVVVLNAVKSFNLDLKKVNINGGGISIGHPLGATGARIAGTLARQLANKRKRYGIATLCVG 383
11499825  401 GGQGGATIIENP 412
119871549 391 GGQGAAVVLERV 402
145591299 391 GGQGAAVVLERV 402
126459263 391 GGQGAAVVLERV 402
18314226  391 GGQGAAVVLERV 402
227829335 384 GGQGGAIVLERV 395
15899236  384 GGQGGAIVLERV 395
16081433  385 GGQGYSVVFERY 396
13542135  385 GGQGYSVIFERY 396
48478095  384 GGQGYSLLMERI 395
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap