Conserved Protein Domain Family
PRK06398

?
PRK06398: PRK06398 
aldose dehydrogenase; Validated
Statistics
?
PSSM-Id: 235794
View PSSM: PRK06398
Aligned: 8 rows
Threshold Bit Score: 442.349
Threshold Setting Gi: 48477302
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
13540906    1 MEEFTDKVAIVTGGSSGIGLAVVDALVRYGAKVVSVSLDEKSDv-nVSDHFKIDVTNEEEVKEAVEKTTKKYGRIDILVN 79 
284997302   2 DLGLKDKVAIVTGGSQGIGKGVVNVLKEENVNVINFDIKEPSY---DVDYFKVDVSKKEQVIKGIDYVISKYGRIDILVN 78 
229584341   2 DLGLKDKVAIVTGGSQGVGKGVVNVLKEENVNVINFDIKEPSY---DVDYFKIDVSKKEQVIKGIDYVISKYGRIDILVN 78 
227829703   2 DLGLKDKVAIVTGGSQGIGKGVVNVLKEENVNVINFDIKEPSY---DVDYFKVDVSKKEQVIKGIDYVISKYGRIDILVN 78 
229578607   2 DLGLKDKVAIVTGGSQGIGKGVVNVLKEENVNVINFDIKEPSY---DVDYFKVDVSKKEQVIKGIDYVISKYGRIDILVN 78 
16081826    2 FSDLRDKVVIVTGASMGIGRAIAERFVDEGSKVIDLSIHDPGEa--KYDHIECDVTNPDQVKASIDHIFKEYGSISVLVN 79 
48477302    1 MRGLKNKNVIVTGGSKGIGAAIVSRFMDEGSNVFSISRSMPEKminKVKYLKCDVSNEDEVYNTINEISSQCGNIDVLVN 80 
159041972   2 YPDLRGKVVIVTGGSSGIGLAIVRRFIEEGSLVVNFDVKEPRDn--ASEFIKVDVSNHGEVNDAVNRVAGKYNRIDVLVN 79 
13540906   80 NAGIEQYSPLHLTPTEIWRRIIDVNVNGSYLMAKYTIPVMLAIGHGSIINIASVQSYAATKNAAAYVTSKHALLGLTRSV 159
284997302  79 NAGIESYGAIHAVEEDEWDRIINVNVKGIFLMSKYTIPYMLKQDKGVIINIASVQSFAVQRRVAAYATSKHAVLGLTRSI 158
229584341  79 NAGIESYGALHAVEEDEWDRIINVNVKGIFLMSKYTIPYMLKQDKGVIINIASVQSFAVQRRVAAYATSKHAVLGLTRSI 158
227829703  79 SAGIESYGAIHAVEEDEWDRIINVNVKGIFLMSKYTIPYMLKQDKGVIINIASVQSFAVQRRVAAYATSKHAVLGLTRSI 158
229578607  79 NAGIESYGAIHAVEEDEWDRIINVNVKGIFLMSKYTIPYMLKQDKGVIINIASVQSFAVQRRVASYATSKHAVLGLTRSI 158
16081826   80 NAGIESYGKIESMSMGEWRRIIDVNLFGYYYASKFAIPYMIRSRDPSIVNISSVQASIITKNASAYVTSKHAVIGLTKSI 159
48477302   81 NAGIEKYASLGKTDSGTWNEIINTNMNSVFYVSREVIKHM---KTGSIVNVSSVQADIVTRNAAAYVTSKHAIIGITKSI 157
159041972  80 NAGIELYGRVHDIDLRDWNRVINVNVNGAFYMARSVIPIMLKTGGGVIINVASVQSTVATRNAAAYVVSKHALLGLTRAI 159
13540906  160 AIDYAPKIRCNAVCPGTIMTPMVIKAAKMEVGEDenAVERKIEEWGRQHPMGRIGRPEEVAEVVAFLASDRSSFITGACL 239
284997302 159 AVDYAPTIRCVAVCPGSIRTPLLEWAKEKEVGKD--HVEDKIREWGEMHPMKRVGKPEEIGYLVAFLASDLASFINGECV 236
229584341 159 AVDYAPTIRSVAVCPGSIRTPLLEWAAEKEVGKD--HVEDKILEWGEMHPMKRVGKPEEIGYLVAFLASDLASFINGECI 236
227829703 159 AVDYAPTIRCVAVCPGSIRTPLLEWAAEKEVGKD--HVEDKIREWGEMHPMKRVGKPEEIGYLVAFLASDLASFINGECV 236
229578607 159 AVDYAPTIRCVAVCPGSIRTPLLEWAAEKEVGKD--HVEDKIREWGEMHPMKRVGKPEEIGYLVAFLASDLASFINGECV 236
16081826  160 ALDYAPLLRCNAVCPATIDTPLVRKAAELEVGSDpmRIEKKISEWGHEHPMQRIGKPQEVASAVAFLASREASFITGTCL 239
48477302  158 AVDYAPAIRCNAVLPGTIDTPLVDMAAMLEVGKDpeKIARKKLEWGNLYPMKRIGRPDEVASVVAFLASDESSFITGSSI 237
159041972 160 AVDYAPLIRAVAVCPGSILTPLLVWAAELEVGHDeeAIRRKINEWGSLHPMGRVGEPEEVANVVAFLASQQASFITGTCV 239
13540906  240 TVDGGLLSKLPISTPNADNS 259
284997302 237 TIDGGLRALIPLSSPKIGTK 256
229584341 237 TIDGGLRALIPLSSPKIGTK 256
227829703 237 TIDGGLRALIPLSSPKIGTK 256
229578607 237 TIDGGLRALIPLSSPKIGTK 256
16081826  240 YVDGGLSIRAPISTPE---- 255
48477302  238 YVDGGLSVLAPVSTPDK--- 254
159041972 240 YVDGGLTALLPQSTPRPKT- 258
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap