Conserved Protein Domain Family
PRK06380

?
PRK06380: PRK06380 
metal-dependent hydrolase; Provisional
Statistics
?
PSSM-Id: 180548
View PSSM: PRK06380
Aligned: 4 rows
Threshold Bit Score: 699.328
Threshold Setting Gi: 289596484
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16082586    1 MSTLIENALIVTQDEGRRIFHGNVQFEGDTITYVGTGRPASDEIIDATGKVVMPGFINTHAHVGMSASKGLFDDVDLERF 80
gi 13541346    1 MSIAISNAIIVTQNDNRDVYRGNVKIDGNKIQYVGKDEVDGDILIDGTNKVLMPGLINTHAHVGMSASKGLFDDVDLDSF 80
gi 48477797    1 MSILIKNAMILRD---LKFIKSDVLIDGNIIKKTGEIKDYADYIIDAKCNLLIPGFVNTHAHVAMTGFKGLLDDTVLSDF 77
gi 289596484   1 MSILIKNAWIVTQNEKREILQGNIYIEESKIVEIGDVNEEAEYVLNASGKIVMPGLINTHTHVGMTDMRGMADDVNLEEF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16082586   81 LDMTFKYDSQRTEEGIFNSARLGMYEMINSGITSFVDLYYSENVIARAAEQVGIRAFLSWVTLDREFTTQKGDPLDNAEN 160
gi 13541346   81 LKKTFEYDSDRTSTGIFNSAKLGMYEMIGNGITAFVDLYYSEDIIAKAAEEIGIRAFLSWVTLDKELTTQIGDPVENAEN 160
gi 48477797   78 LEKSGDLDSSRTDNGIYNSSLLGMYEMINSGITTFVDLYYSEDIIQRAAEKTGIRAYLAWAVLDDEYTTQKGSPVKNAEH 157
gi 289596484  81 LMKMWKEEAKRGREEIYKGAKLGIKEMLRTGTTAFVDMYSDEDAIAKAAKELGIRAFLGWAVVDEDITTQEGNPLNNAEN 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16082586  161 FIRSHQNMRFVKPSVGVQGIYVASDETYQRAKEIAERYDTIMHMHLSETRKEVYDSVKKIGERPIEHLDKIGVLSSRVIA 240
gi 13541346  161 FIRNHVGNKYVVPSVGVQGIYVANDDTFRRAMDLAEKYGTILHMHLSETRKEVYDAVKKLGERPIEHLHNIGILNKRVLA 240
gi 48477797  158 FI-TMDHPENVTPMIGVQGIYVSSDETYMKVLDLSKKYNVMMHTHLSETRKEVYDTVKRYGERPVEHLNKINFLSDKLIA 236
gi 289596484 161 FIKEFRNEELITPLIAPHAVYTCNEETLLKAKEIAEKYDTLITMHISETRKEVYEHRKRTGMRPVEWLEKIEFLNSKLIA 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16082586  241 AHCVWATYHEAKLLGKNGVNVSWNAVSNFKLATGGVPPVPEMLDAGVNITIGTDSNGSNNSLNFFEAMKFSALTVKNARW 320
gi 13541346  241 AHCVWATYHEVRLLSKDGVNVSWNSISNFKLGTGGIPPIPEMMRENVNVTIGTDSNGSNNSLDMFQAMKFSAISVKNYRW 320
gi 48477797  237 AHCVWVTINEIKMLSKNNVKVSWNSVSNAKLASGGNAPIPEMLNNNINVSIGTDSSGSNNSLDMFQEMKFSLLSINNERW 316
gi 289596484 241 AHLVWLTLHEIKILAKNGVKASHNPTSNMKLGNGGSMPLPEMLDNGILVTLGTDSTVSNNNLDMFEAMKFAALLHKNERW 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16082586  321 DASIIKSQQILDFATIDAAKALRLNAGSIEVGKKADIVILDARRPELIPTDKNNVVNNIVYSTNPASVDSVIIDGVFRKK 400
gi 13541346  321 DASLMKAQEILDMATRNAARALQLNAGSIEVGKLADVVLLDATIPSMIPTNEANAVSNIVYSSSPQNVDTVIIDGEIKKI 400
gi 48477797  317 DPSIIKSNDVFKMATLNGYSALNLNGGIIEPGSIADLIIIDRRAVNMIP--GNDFIKNIVFSGNPSNVLYVIVNGKILKE 394
gi 289596484 321 DASITNAQEILDFATINAAKALELNAGSIEEGRLADLVILNP-APNGLPLRKNTIVSNIVYSLTGLNVEHTIVNGKI--- 396
                        410
                 ....*....|....*....
gi 16082586  401 GGRLIGFDEGGVASANvFV 419
gi 13541346  401 NGKILGFHSNKFTNSE-FK 418
gi 48477797  395 NGRLNNFNPDEFIDAE-FL 412
gi 289596484 397 -----------------VI 398
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap