Conserved Protein Domain Family
PRK06366

?
PRK06366: PRK06366 
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 102340
View PSSM: PRK06366
Aligned: 3 rows
Threshold Bit Score: 771.102
Threshold Setting Gi: 48478577
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16081685   1 MRDVFIVAAKRTAIGKFGRSFSKLKAPQLGGAAIKAVMDEAHVDPASVEEVIMGNVIQAGNGQNPAGQAAFHGGLPNSVL 80 
13541480   1 MNDVYIVSAKRTAIGKFGRSFSKIPAPQLGGAAIKAVIEDSGIDKSAIQEVIMGNVIQAGVGQNPAGQAARAAGLADEIT 80 
48478577   1 MKDVYIVSAKRTPIGKFGKGFSKIKATELGGKAIRAAIDDAKLDPALVQEVIMGNVIEGGVGQNPAGQAAYHAGLPFGVT 80 
16081685  81 KYTVNVVCASGMLAVESAAREIALGERDLVIAGGMESMSNAPFLLPADLRWGPKHLLHKNYKIDDAMLTDGLLDAFYFEH 160
13541480  81 KYTVNVVCASGMLAVESAAREIKLGEREIVIAGGMENMSNAPFLLPSDLRWGPKHLLHKNYKIDDAMLVDGLTDAFYFEH 160
48478577  81 KYTVNVVCASGMLAVESAAREIMLGERDLIVAGGMENMSMSPLLLSSEFRWGPKQLLYKNMKIEDSMLVDGLIDAMYYEH 160
16081685 161 MGVSAERTSRKFGITREMADEYSVQSYERAIRATESGEFADEIVQFEGLDHDEGIRKTTMEDLARLPPAFDKNGILTAGN 240
13541480 161 MGVSAERTAKKYGITREMADEYSVQSYERAIRATNTGEFSKEITVFSNLSQDEGIRKTTMEDLAKLPPAFDKNGILTAGN 240
48478577 161 MGVSAERSARKYNLTREDADSYSVQSQERAIRATESGEFRNEIVPVNDIDRDEGLRKTTMKDLEKLNPAFDRDGILTAGN 240
16081685 241 SAQLSDGGSALMIASEKAINEYGLKPIARITGYEQASLDPLDFVEAPIPATRKLLEKQHKSIDYYDLVEHNEAFSIASVI 320
13541480 241 SAQLSDGGSALLLASEKAINEYGLKPIAKITGYESASLAPLDFVEAPIPATRKLLERQGKSIDYYDIVEHNEAFSIASII 320
48478577 241 SSQLSDGASALVMASEKAINEYDLKPIARITGYESASLDPRDFVEAPIPATKKLLEKQNKSIDYYDLVEHNEAFSVASII 320
16081685 321 VRNELKIDNERFNVNGGAVAIGHPIGNSGARIIVTLMNALKHRHLKTGLATLCHGGGGAHTLTLEMVE 388
13541480 321 VRDQLHIDNERFNVNGGAVAIGHPIGNSGSRIIVTLINALKERHMKTGLATLCHGGGGAHTLTLELVD 388
48478577 321 VRDQLKIDNERFNVNGGAIAIGHPLGNSGSRIIVTLINALKTRHMKTGLATICHGGGGGHTITLEMVE 388
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap