Conserved Protein Domain Family
PRK06365

?
PRK06365: PRK06365 
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 235785
View PSSM: PRK06365
Aligned: 4 rows
Threshold Bit Score: 722.082
Threshold Setting Gi: 302342967
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16081480   18 MKEKARNVYMVAGGVTKFAKASPEMDFRLRVKKAFDYAMNDAGLTLADIDGSVAS----YFSDHFQRQLMSGIMVQDYLG 93 
13542091    1 MKSKGRDVYMVAGGVTKFSKASPDMDFRLRVKKAFDYAMNDAGLTLADIDGSVAS----YFSDHFQRQLMAGIMVQDYLG 76 
48478260    1 ----MRDVYIVSAGLTKFVKADQNNDYREKVREAFEYAKNDVKIKNDDIDGSVCA----YFSDHVQGQLLAGVLVNDYIG 72 
302342967  11 IPKMSRPVYLVTAGQSKFDRAMPYKRTEELCIDALAMAARLIDKTPAELKKYIHTcyygHFADHFGDQLLGEAVIHDRLG 90 
16081480   94 LVPKPSKRIEGGGATGGLAFQAGYEEIASGRMDTVAVYGFETMSHVNTWKGNEFIALASDTNFDYPIGGFYTGYYAMMAV 173
13542091   77 LVPKPSKRIEGGGATGGLAFQAGYEEIASGRMDAVVVYGFETMSHVNTWKGNEFIALASDTNFDYPIGGFYTGYYAMMAV 156
48478260   73 LAPKPSKRIEGGGATGGLAVQAGYEEIASGNMDVCAVYGFENLSRLTTWKGNEVIALASDINFDFPLGGFYTAYYALMAT 152
302342967  91 LDPLGNVGVKTGGATGGSTLWEAAKAVASGYSDCVLAMGWERMDEVPTDEGNNYISCAADKDWETPLGHIYTGYYAVMAQ 170
16081480  174 RHMYEFGTTVEQ----LAKVSVKNHGNALHNPYAQSPMKLTVEDVRNAPMVSYPLTRLDVCAMSDGAAVAILASEDKAFE 249
13542091  157 RHMHEFGTTVEQ----MAKVSVKNHGNAIHNPYAQSPMKITVEDVRKAPMVSYPLTRLDVCAMSDGAAVAILASEDKAFE 232
48478260  153 RHMYEFGTTVEQ----MAMVSVKNHGNAIYNKFAQSPMKLTVDDVRKSPMVSTPLTRLDICNMSDGAACLILASKDKAYS 228
302342967 171 KYWQVFGKQEESfrrtLAEISVKHHGYARFNPFAQAPMKISVEDVLQSPVVAYPLRALDCCLMSVGAACAIVCDEQTALE 250
16081480  250 IT----DHPVLIKGIGTGTDSMRLADRPFGDVPLLPNEKPSDYKDL--------KYPGVHSFRAGRMAAKEAYEMAGITD 317
13542091  233 IT----DHPVLVKAIGTGTDTMRLSDRPFGEVPLLPNESPSDYKGL--------KYPGVHSFRAGRMAAKEAYEKAEITD 300
48478260  229 IT----DKPVKIEAIGSASDTLRLADRPFGEVPLLPNENKDDYKNL--------RYPGVHSFRAGRLAAIQAYKRANIKD 296
302342967 251 LTkgtaNKPLRI-WVTAGSHTLRPACRRDMAIPLLPNESADQYKDLgqrfpggeRYPGFTGFLAARMAAYYAYNMVGIQD 329
16081480  318 PLNELDLIELHDAYTSSEIQTYEDLGLCKYGEGGQFIDEG-------KPELHGKIPVNPSGGLLAAGHPVGATGIMQAVF 390
13542091  301 PINDLDLIELHDAYTSSEIQTYEDLGLCKYGEGGQFIDEG-------KPELKGKIPVNPSGGLLAAGHPVGATGIMQAVF 373
48478260  297 PLNDIDFAEVYDSYTSAEIQAYEDLGFCKYGEGGKFIESG-------SPMIDGDLPVNASGGLLASGHAIGATGIMQAVY 369
302342967 330 PSEDLDVIELHDAFTISDVQTYEDVGIRPYGYGRDYVESGdcyhtnpKTGQPGKLPSNLSGGLIGCMHAVGATGIMQVFE 409
16081480  391 M----------------FWQLQHTIKKHFHDDYLQVPNAKRGLIHSHAGTGTYVTVTIMEAAK 437
13542091  374 M----------------FWQLQHTIKKHFHDDYLQVPNAKRGLIHSHAGTGTYVTVTIMEAVK 420
48478260  370 A----------------FWQIQGRIERHLGSNRLQVKNANRGVVHSHAGTGAYETVTILKGD- 415
302342967 410 IalqlwnrwaelhgdpaLWEAFGRVKPDDWTD-LQVKGAKRAMAISHAGVGSHVTATILMDPD 471
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap