Conserved Protein Domain Family
PRK06364

?
PRK06364: PRK06364 (this model, PSSM-Id:102338 is obsolete)
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 102338
View PSSM: PRK06364
Aligned: 3 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
48477455  15 ITLSDVYIIGAGETKFGELWDKSLRNLAVEAGLKAIENAGIYSKDIDIIYGANGLAGVINKQENIGALIADFSGLSEEGI 94 
16082423   1 MALSDVYIIGAGETKFGELWDKSLRDLAVEAGLEAIKDANIYSRDLQMLYASNSLAGTINEQSNIAALAADFSGIAETHV 80 
13540962   2 ELSNDVYIIGAGETKFGELWDKSLRDLAVEAGLEAIKDANIYSKDLQMLYASNSLAGTINEQSNIAALAADFSGIAENHV 81 
48477455  95 PAIRIEASTASGAAAVHEAYLAIKSGEYNVAVVGGVEKMTDIHGHEINEVMSSILDREWESFYGATPASMAALIARKYMK 174
16082423  81 PAVRVEASTASGGAAVREAYLAIKSGEYDVVMVGGVEKMTDIYGSEIIDVQSSILDREWESFNGATPAALAAITARRYMH 160
13540962  82 PAVRVEASTASGGAAVREAYLAIKSGEYDVVMVGGVEKMTDIYGTEIIDVQSSILDREWESFNGATPAAMAAIAARRYMH 161
48477455 175 DFNIEKEALSMISVNDHENASRNPDAQYRNKISLKQAMESVMVADPLTLMDCSPISDGAAAIVLASEDFVKRNKKDGVKI 254
16082423 161 DFKVPREDIAMIAVNDHANASMNPDAQYRNKITVEQVINSDPVAEPLNVFDCSPISDGASAIILASDEYRKKNRLDGIRI 240
13540962 162 DFNVEREAISMVAVNDHANASLNPDAQYRNKITVDQVLNSDPVAEPLNVFDCSPITDGASAIILASEGFVKKNRIDGVRI 241
48477455 255 LASAIAEDYLDVGSRKSIYTFNSTKKAARLAFDRAGIKSDDVSFAEIHDSFSIYGLLALEDLGFADKGNAKDLVyDEIKL 334
16082423 241 VSSAMSEDYLALHSRKSIYTLESARIASKQALERAGIKKNDISFLELNDSYSIYGLLELEDLGFAEKGKGRELL-GEIKI 319
13540962 242 LSSAMAEDYLALHSRKSIYTLESTKIATEEALKKAGIKREDVSFLELNDSYSIYGLLELEDMGFAEKGKAKDLVyDDIKL 321
48477455 335 SGRIPLNPSGGLKAKGDPYGAVGVGQFVEAYLQLMEKAGDRQVKSPRYGLLHNMAGTGATSVVHILGD 402
16082423 320 NGSLPVNPSGGLKAKGNPLGATGVSQFYEAYLQLKGKAGQRQVKGARYGMLHNMAGTGATSVVHIVGE 387
13540962 322 NGRLPVNPSGGLKAKGNPLGATGVSQFFEAYLQLKGKAGQRQVKDARYALLHNMAGTGATSVVHVVGE 389
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap