Conserved Protein Domain Family
PRK06363

?
PRK06363: PRK06363 (this model, PSSM-Id:102337 is obsolete)
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 102337
View PSSM: PRK06363
Aligned: 22 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
150400460   1 MRDVAIIGYGQTKFGELWDKSFRDTIVEAGANAIIDANIEGADIDAMYIGNMSGGLFVGQEHISSLIADYTGFNPIPCTR 80 
148643622   1 MRDVAIIGVSQTKFGELWDSSFRDLIAEAGVKAVMDAEVEGDDIEAMYVGNMSSGLFVDQEHIAALISDHMGLNPIPTTR 80 
15669744    1 MRDVAIIGYGQTKFGELWERSFRSLIVEAGVKAVEAAGIDGKDIDEMYVGNMSAGLFVGQEHIASLIAEHAGLNPIPSTR 80 
134045423   1 MKDVAIIGYGQTKFGELWEESFRSLIVEAGTKAIIDANVDGDDIDAMYVGTMSGGLFVGQEHTASLIADYAGLNPIPCTR 80 
159905843   1 MKDVAIIGYGQTKFGELWEESFRSLIVEAGTKAIIDANVDGDDIDAMYVGTMSGGLFVGQEHTASLIADYAGLNPIPCTR 80 
150402385   1 MKDVAIIGYGQTKFGELWEESFRSLIVEAGTKAIIDANVDGDDIDAMYVGTMSGGLFVGQEHTASLIADYAGLNPIPCTR 80 
45358775    1 MKDVAIIGYGQTKFGELWEESFRSLIVEAGVKAISDANVDGDDIDAMYVGTMSGGLFVGQEHSASLIADYAGLNPVPCTR 80 
150399279   1 MKDVAIIGYGQTKFGELWEESFRSLIVEAGTKAISDANVDGNDIDAMYVGTMSGGLFVGQEHTASLIADYAGLNPVPCTR 80 
20094814    7 RRDVAIVGVGMTRFGELWERSFDDLFVEAGLEALEDAGMGGDEIEAMYVGNMSAGRFIDQEHVASLIADRSGLTPIPCTR 86 
15678815    1 MRDVAVIGVSQTKFGELWDVSFRDMITEAGLGAIEDAGVEGADLDAMYVGNMSAGLFIKQEHISSLIADHAGLTPIPSTR 80 
150400460  81 VEAACASGSLAIRSAYLSVASGAHDVVLAGGVEKMTDVE--DATSAIATAADQEWESFFGATFPSLYAMMAKRYMYEFGM 158
148643622  81 VEAACASGGLALRQGIMAVASGFHDVVISAGVEKMTDVV--DATPAIATASDQEWEAQQGATFPSLYAMIAKRHMYEYGT 158
15669744   81 VEAACASGSLALRQAVLNVASGASDVVLVGGVEKMTDVV--DATSAISSASDQEWEALFGATFPSLYAMMAQRYMYEYGL 158
134045423  81 VEAACASGSLALRSAFLSIASGAHDVVLVGGVEKMTDVS--DATSAIATASDQEWEAFVGATFPSLYAMMAKRYMKEYGL 158
159905843  81 VEAACASGSLALRSAFLSIASGAHDVVLVGGVEKMTDVS--DATSAIATASDQEWEAFVGATFPSLYAMMAKRYMQQYGL 158
150402385  81 VEAACASGSLALRSAVLSIASGAHDVVLVGGVEKMTDVS--DATSAIATASDQEWEAFVGATFPSLYAMMAKRYMQQYGL 158
45358775   81 VEAACASGSLALRSACLSIASGAHDVVLVGGVEKMTDVA--DATSAIATASDQEWEAFVGATFPSLYAMMAKRYMHEYGL 158
150399279  81 VEAACASGSLALRSAFLSIASGAHDIVLVGGVEKMTDVP--DATSAIATASDQEWEAFVGATFPSLYAMMARRYMFQYGL 158
20094814   87 VEAACASGGLAVRQAILAVASGMYDIVLAGGVEKMTDVTteEATATLATAADQEWEAFHGVTFPALYAMIARRHMYEYGT 166
15678815   81 VEAACASGGLALRSGIMAVASGYHDIVIAAGVEKMTDVV--DPTPAIATASDQEWEAQQGVTFPSLYAMMARRHMYEYGT 158
150400460 159 TIDELSMWSVIAHDNASKNPYAQFQFKTTLEKVLNASPVADPLTLMHCSPVSDGGAALIICDADKAEEYApkDEIMYIRA 238
148643622 159 TREQLAQFSVVNHKNAKNNPNAQFPFEISVDKVINSTMVADPLTLLDCSPVSDGAAAVVMVPAEDAKKYT--DTPIYVRA 236
15669744  159 TLEELSMWSVIMHENASKNRYAQFPFKVTLEQVLNSSPVAEPLRLLHCSPVSDGAAALIVCEAEKAKEFVnkDDIIYIKA 238
134045423 159 TLEQLSSWSAIAHENAVHNNYAQFRSKITIDQIMRASPVADPLTLLHCSPVSDGASALIVCDAEKATDYApkDEIIYIKA 238
159905843 159 TIEQLSSWSAIAHENAVHNRYAQFRSKITVDQVMRASPVADPLTLLHCSPVSDGASALIICDAEKATQYApkDEIIYIKA 238
150402385 159 TIEQLSSWSAIAHENAVHNRYAQFRSKVTIDQIMRASPVADPLTLLHCSPVSDGASALIICDAEKATQYApkDEIIYIKA 238
45358775  159 TIEQLSSWSAIAHENAVHNKYAQFRSKVTIDQVMRASPVADPLTLLHCSPVSDGASALIICDAEKATEYApkDEIIYIKA 238
150399279 159 TLEQLSTWSSIAHENAVHNKYAQFRSKVTVDQVIHASPVSDPLTLLHCSPVSDGASALIICNAEKATEYApkDEIIYVKA 238
20094814  167 TREHLALPPVKNHRNATKNPKAQFQFEITVEQVIESPLVADPLRLLDCSPVSDGAAAVIVCPLEMAKEFT--DTPIVVRA 244
15678815  159 TREQLAMVSVINHENASNNPRAQFPMKVTVEQVMNSTMVADPLRLLDCSPISDGAAAVILCPADMAREYT--DTPVYVKA 236
150400460 239 STQASDTIALHSRKSMTTLNAAKVASEQAYKLAGVDANKIDVAEVHDCFAINGLILLEDLGFCKKGEAKTVIgQEEKIRI 318
148643622 237 SAQASGTIALHNRKDLTTIDSTKVASRKAYEMAGVTTKDIDLAEVHDCFSINGLLAVEDLGFAEKGKGGIAI-EEGQTEI 315
15669744  239 SVQASDTIALHSRESITSLKAAKVASEKAYKMANIEPKDVDVAEVHDCFAINGLILMEELGFCKKGEAGKIV-YDKKIAI 317
134045423 239 STQASDTIALQDRNDMTTLNAAKVASKKAYEIAGINASQVDVAEVHDCFAINGLVLTEDLGFCKKGEAGKVV-EAGKTRI 317
159905843 239 STQASDTIALHDRKDMTTLNAAKVASNKAYQIAGINASQVDVAEVHDCFAINGLVLTEDLGFCKKGEAGKVV-EAGKTRI 317
150402385 239 STQASDTIALHDRKDMTTLNAAKVASNKAYEIAGINASHVDVAEVHDCFAINGLVLTEDLGFCKKGEAGKVV-EAGKTRI 317
45358775  239 STQASDTIALHDRKDMTTLNAAKVASDKAYKIAGIDAKKVDVAEVHDCFAINGLVLTEDLGFCKKGDAGKVV-ESGKTRI 317
150399279 239 STQASDTIALHDRPDMTTLNAAKVASKKAYEIARIDASKIDVAEVHDCFAINGLVLTEDLGFCKKGEAGKIV-ESGKTRI 317
20094814  245 TAQASDSIALHDREDITTLKATVEAAKTVYKQAGVEPEEVDVAEVHDCFSIAELVAVEDLGFVEKGEAGEAY-HEGMFEI 323
15678815  237 SAQASGTIALHDRRDITRIDATVNAARNAFKMAKLTPGDIDLVEVHDCFSINGILAVEDLGFVEKGEGGRAF-EDGMTRI 315
150400460 319 DYDnfVTVNPSGGLKAAGHALGATGIRQVGEIYWQLKQDKNCKNRQVqinnGYGITANVGGTGGTVCTHIISD 391
148643622 316 DGD--FPINPSGGLKARGHPLGATGIAQAAEVVWQLRGDAGKRQVDGa---EIGMTHNIGGTGGTAAVHIFGR 383
15669744  318 DYDgfPAVNPSGGLKAAGHALGATGIRQVGEIYWQLKQDKEVKDRQVeiknGYGITVNVGGTGGTVCIHILSD 390
134045423 318 DDDsfVTVNPSGGLKAAGHALGATGIRQVGELYWQLKQDKECKDRQVtienGYAISANVGGTGGTVCTHILSN 390
159905843 318 DDDsfVTVNPSGGLKAAGHALGATGIRQVGELYWQLKQDKECKDRQTaiknGYGIAANVGGTGGTVCTHILSN 390
150402385 318 DDEsfVTVNPSGGLKAAGHALGATGIRQVGELYWQLKQDKECKDRQTaiknGYAIAANVGGTGGTVCTHILSN 390
45358775  318 DDEsfVTVNPSGGLKAAGHALGATGIRQVGELYWQLKQDKECKDRQAaiknGYAIAANVGGTGGTVCTHVLSN 390
150399279 318 DNEsfVTVNPSGGLKAAGHALGATGIRQVGELYWQLKQDKECKDRQSsiknGYAIATNVGGTGGTVCTHILSN 390
20094814  324 DSDy-VAVNPSGGLKAKGHPVGASGVAQVVEIVEQLRGEAGKRQVDGa---EIGLTHNVGGSGGTVVVHIFER 392
15678815  316 DGD--IPVNPSGGLKARGHPLGATGIAQAAEVVWQLRGEAGKRQVEGa---EIGMTHNIGGTGGTAAVHIFSR 383
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap