Conserved Protein Domain Family
PRK06333

?
PRK06333: PRK06333 
3-oxoacyl-(acyl carrier protein) synthase II; Reviewed
Links
?
Statistics
?
PSSM-Id: 235781
View PSSM: PRK06333
Aligned: 50 rows
Threshold Bit Score: 647.056
Threshold Setting Gi: 297621594
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
89901908    2 NKQRVVVTGMGLVTPLGCGVETVWQRLAAGASGLRRLSDEFCRGLDAQVGATVPSvqedaeagLDIDRVVSGKDQKKMDR 81 
15834771    2 NKKRVVVTGMGIVSCLGNEVESFYDSLLAGISGVRTITSFPCDDYATRFAGWIEE--------FNSEPYLDKKQARRVDP 73 
297621594   3 KRTRIVVTGLGIVSCHGDDVDAFYRQLLEGKSGISTITGFSTEDLATTFAGEIRD--------FDPGKYMDKKQARRVDK 74 
62185423    2 SKKRVVVTGLGVVSCLGNEIDTFYDNLLAGVSGVRTITSFPCEDYATRFAGWIPE--------FNPEPYLDKKQARRVDC 73 
89897970    2 NKKRVVVTGLGVVSCLGNEVDTFYDNLLAGISGVHTITSFPCEDYATRFAAWIPE--------FNPEPYLDKKQARRVDP 73 
29840610    2 NKKRVVVTGLGVVSCLGNEIDTFYDNLLAGISGVRTITSFPCEDYATRFAAWIPE--------FNPEPYLDKKQARRVDP 73 
16752120    2 SKKRVVVTGFGVVSCLGNEVDTFYDNLLAGVSGVRPITSFPCEDYATRFAGWIPE--------FNPEPYVDKKQARRVDP 73 
15618825    2 SKKRVVVTGFGVVSCLGNEVDTFYDNLLAGVSGVRPITSFPCEDYATRFAGWIPE--------FNPEPYVDKKQARRVDP 73 
15836449    2 SKKRVVVTGFGVVSCLGNEVDTFYDNLLAGVSGVRPITSFPCEDYATRFAGWIPE--------FNPEPYVDKKQARRVDP 73 
33242279    2 SKKRVVVTGFGVVSCLGNEVDTFYDNLLAGVSGVRPITSFPCEDYATRFAGWIPE--------FNPEPYVDKKQARRVDP 73 
89901908   82 FIVLALAAADQALQQAGWQAQSPH--ARERTATIIASGIGGFPAIAEAVRTTDLRGPRRLSPFTVPSFLINLAAGHVSLR 159
15834771   74 FITYAVVAAKKAIAMSRWDQETLPa-NPHRCGVIIGSGMGGLRTLDEGIEKL-SAGNRKLSPFFIPYIITNMAPALIAMD 151
297621594  75 CIAYTMVAGKKALESAGLNEEALNqvDLEKCGAIIGSGMGGMGVFVDGVQSMSKQGPKRVTPFFIPYILTNMGGALFAMD 154
62185423   74 FITYAVVAAKKAIAMSRWDKDNLPa-DPLRCGVIIGSGMGGLQTLDDGMERL-ILGNKKLSPFFIPYIITNMAPALIAMD 151
89897970   74 FITYAVVAAKKAIAMSRWDKDNLPa-DPLRCGVIIGSGMGGLQTLDEGMERL-IQGNKKLSPFFIPYIITNMAPALIAMD 151
29840610   74 FITYAVVAAKKAIAMSRWDKDNLPa-DPLRCGVIIGSGMGGLQTLDEGMERL-ILGNKKLSPFFIPYIITNMAPALIAMD 151
16752120   74 FITYAMVAAKKAIAMSRWDKDHLPs-DPVRCGVIVGSGMGGLSTLDQGMERL-LVIHKKLSPFFIPYIITNMAPALIAMD 151
15618825   74 FITYAMVAAKKAIAMSRWDKDHLPs-DPVRCGVIVGSGMGGLSTLDQGMERL-LVIHKKLSPFFIPYIITNMAPALIAMD 151
15836449   74 FITYAMVAAKKAIAMSRWDKDHLPs-DPVRCGVIVGSGMGGLSTLDQGMERL-LVIHKKLSPFFIPYIITNMAPALIAMD 151
33242279   74 FITYAMVAAKKAIAMSRWDKDHLPs-DPVRCGVIVGSGMGGLSTLDQGMERL-LVIHKKLSPFFIPYIITNMAPALIAMD 151
89901908  160 YGFKGPIGAPVTACAASVQALGDGARLIRSGEADVVVCGGTEAAINLVTQAGFAAARALSTGyNDCPTQASRPFDRNRDG 239
15834771  152 YGLMGPNYSISTACATANYCIDAAYQHLVEGRADVIVCGGTEAAINRVGLAGFIANRALSER-NDAPEQASRPWDRDRDG 230
297621594 155 LGFMGPNYSISTACATGNHSIAAAANHIRLGDADVMVCGGVEAAILPMGIAGFNACKALSKR-NDAPEKASRPWDKERDG 233
62185423  152 FGLMGPNYSISTACATSNYCIDAAYQHLVSGRADIIVCGGTEAAVNRVGLAGFIANRALSER-NDAPQEASRPWDRDRDG 230
89897970  152 FGLMGPNYSISTACATSNYCIDAAYQHLVSGRSDMIVCGGTEAAVNRVGLAGFIANRALSER-NDAPQEASRPWDRDRDG 230
29840610  152 FGLMGPNYSISTACATSNYCIDAAYQHLVSGRSDMIVCGGTEAAVNRVGLTGFIANRALSER-NDAPQEASRPWDRDRDG 230
16752120  152 FGLMGPNYSISTACATGNYCIDAAYQHLVSGRADMIICGGTEAAVNRIGLEGFIANRALSER-NDAPDQASRPWDRDRDG 230
15618825  152 FGLMGPNYSISTACATGNYCIDAAYQHLVSGRADMIICGGTEAAVNRIGLEGFIANRALSER-NDAPDQASRPWDRDRDG 230
15836449  152 FGLMGPNYSISTACATGNYCIDAAYQHLVSGRADMIICGGTEAAVNRIGLEGFIANRALSER-NDAPDQASRPWDRDRDG 230
33242279  152 FGLMGPNYSISTACATGNYCIDAAYQHLVSGRADMIICGGTEAAVNRIGLEGFIANRALSER-NDAPDQASRPWDRDRDG 230
89901908  240 FIVGEGAGVLVIESLEHALARGAVPLAELVGYGTSADAYHITSGPEDGNGAARAMQIALRQAGISPNQVQHVNAHATSTQ 319
15834771  231 FVLGEGAGVLVLETLDNALKRGAPIFAEVLGTYTTCDAFHITAPRDDGEGITACILGALNKAGIPKERVNYINAHGTSTP 310
297621594 234 FVMGEGAGILVLERLEHALERGASIVAEYMGHGISCDAHHMTEPRPDGKGIAKCMLSALKDAGLKPEEISYINAHATSTP 313
62185423  231 FVIGEGAGILVLETLENALKRGAPIYAEILGAYTTCDAFHITAPRDDGEGITSCILGALESSGIPKERVNYINAHGTSTP 310
89897970  231 FVIGEGAGVLVLETLENALKRGAPIYAEILGSYTTCDAFHITAPRDDGEGITSCILGALESSGIPKERVNYINAHGTSTP 310
29840610  231 FVIGEGAGVLVLETLENALKRGAPIYAEILGSYTTCDAFHITAPRDDGEGITSCILGALESSGIPKERVNYINAHGTSTP 310
16752120  231 FVLGEGAGILVLETLESALRRDAPIFAEMLGSYVTCDAFHITAPRDDGEGITACVLGALNSAGIPKERVNYVNAHGTSTP 310
15618825  231 FVLGEGAGILVLETLESALRRDAPIFAEMLGSYVTCDAFHITAPRDDGEGITACVLGALNSAGIPKERVNYVNAHGTSTP 310
15836449  231 FVLGEGAGILVLETLESALRRDAPIFAEMLGSYVTCDAFHITAPRDDGEGITACVLGALNSAGIPKERVNYVNAHGTSTP 310
33242279  231 FVLGEGAGILVLETLESALRRDAPIFAEMLGSYVTCDAFHITAPRDDGEGITACVLGALNSAGIPKERVNYVNAHGTSTP 310
89901908  320 VGDAAELAAFRTVFGvpeesvgsPAKGPAISSSKSATGHLLGAAGAVEAIFTVMALRHQVAPPTLNLHEPDPLSKGMDLV 399
15834771  311 LGDLSEVLALKKAFGs-------HIKNLRMNSTKSLIGHCLGAAGGVEAVATIQAIQTGKLHPTINIENPIAEIEEFDVV 383
297621594 314 AGDMVEVNALKQVIP--------DPSKVVMNATKSMIGHGLGAAAGIEAVVTAKAIQEGKVHPTINLENPEPDLGFH--T 383
62185423  311 LGDISEVLALKKAFGs-------HVKKLRMNSTKSLIGHCLGAAGGVEAVATIQAIQTGKLHPTINLENPITEIDDFDVV 383
89897970  311 LGDISEVLAVKKAFGs-------HVKNLRMNSTKSLIGHCLGAAGGVEAVATIQAIQTGKLHPTINLENPIAEIDDFDVV 383
29840610  311 LGDISEVLALKKAFGs-------HVKNLRMNSTKSLIGHCLGAAGGVEAVATIQAIQTGKLHPTINLENPIAEIDDFDVV 383
16752120  311 LGDLSEVLAVKKAFGs-------HVRNLRMNSTKSLIGHCLGAAGGVEAVVAIQAILTGKLHPTINLDNPIAEIEDFDVV 383
15618825  311 LGDLSEVLAVKKAFGs-------HVRNLRMNSTKSLIGHCLGAAGGVEAVVAIQAILTGKLHPTINLDNPIAEIEDFDVV 383
15836449  311 LGDLSEVLAVKKAFGs-------HVRNLRMNSTKSLIGHCLGAAGGVEAVVAIQAILTGKLHPTINLDNPIAEIEDFDVV 383
33242279  311 LGDLSEVLAVKKAFGs-------HVRNLRMNSTKSLIGHCLGAAGGVEAVVAIQAILTGKLHPTINLDNPIAEIEDFDVV 383
89901908  400 QLYSRPVEMEYALSNGFGFGGVNASVVFRRWV 431
15834771  384 ANKSQDWDVDVAMSNSFGFGGHNSTILFSRYE 415
297621594 384 PTEALEMEVKVAVSNSFGFGGHNSSIILGKYK 415
62185423  384 ANKAQDWDIDVAMSNSFGFGGHNSTILFSRYI 415
89897970  384 ANKAQDWDIDVAMSNSFGFGGHNSTILFSRYI 415
29840610  384 ANKAQDWDIDVAMSNSFGFGGHNSTILFSRYI 415
16752120  384 ANKAQDWDIDVAMSNSFGFGGHNSTILFSRYV 415
15618825  384 ANKAQDWDIDVAMSNSFGFGGHNSTILFSRYV 415
15836449  384 ANKAQDWDIDVAMSNSFGFGGHNSTILFSRYV 415
33242279  384 ANKAQDWDIDVAMSNSFGFGGHNSTILFSRYV 415
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap