Conserved Protein Domain Family
dnaE

?
PRK06326: dnaE (this model, PSSM-Id:102320 is obsolete)
DNA polymerase III subunit alpha; Validated
Statistics
?
PSSM-Id: 102320
View PSSM: PRK06326
Aligned: 13 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Jul-2008
Updated: 31-Jul-2008
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62184719     7 VTWIPLHCHSQYSILDATSSIKSFVAKAKEYQIPSLALTDHGNLYGAIEFYKECQQNDIKPIIGCEVYVAPSSRFDKKKE 86
gi 46446023     4 SPFVHLRTHSQYSILDASASISDLSQRAFQEGMSSIALTDHGNLFGIVDFYKACKEVKVKSIIGCELYVAPGSRLEKTKV 83
gi 15835446     1 MTWIPLHCHSQYSILDATCSIKKFVAKAVEYHIPALALTDHGNLFGAVDFYKTCKQNAIKPIIGCELYVAPSSRFDKKKE 80
gi 76789282     1 MTWIPLHCHSQYSILDATCSIKKFVAKAVEYQIPALALTDHGNLFGAVEFYKTCKQNAIKPIIGCELYVAPSSRFDKKKE 80
gi 15605274     1 MTWIPLHCHSQYSILDATCSIKKFVAKAVEYQIPALALTDHGNLFGAVEFYKTCKQNAIKPIIGCELYVAPSSRFDKKKE 80
gi 166154760    1 MTWIPLHCHSQYSILDATCSIKKFVAKAVEYQIPALALTDHGNLFGAVEFYKTCKQNAIKPIIGCELYVAPSSRFDKKKE 80
gi 166155635    1 MTWIPLHCHSQYSILDATCSIKKFVAKAVEYQIPALALTDHGNLFGAVEFYKTCKQNAIKPIIGCELYVAPSSRFDKKKE 80
gi 29839841     1 MTWIPLHCHSQYSILDATSSIKSFVAKAKEYQIPSLALTDHGNLYGAIEFYKECRQNDIKPIIGCEIYVAPTSRFDKKKE 80
gi 89898738     1 MTWIPLHCHSQYSILDATSSIKSFVAKAKEYQIPSLALTDHGNLYGAIEFYKECYQQDIKPIIGCEVYVAPSSRFDKKKE 80
gi 16752374     1 MTWIPLHCHSQYSVLDAMSSIKDFVAKGQEFGIPALALTDHGNLYGAVDFYKECTQKGIQPIIGCECYIAPGSRFDKKKE 80
gi 15618576     1 MTWIPLHCHSQYSVLDAMSSIKDFVAKGQEFGIPALALTDHGNLYGAVDFYKECTQKGIQPIIGCECYIAPGSRFDKKKE 80
gi 15836198     1 MTWIPLHCHSQYSVLDAMSSIKDFVAKGQEFGIPALALTDHGNLYGAVDFYKECTQKGIQPIIGCECYIAPGSRFDKKKE 80
gi 33242023     1 MTWIPLHCHSQYSVLDAMSSIKDFVAKGQEFGIPALALTDHGNLYGAVDFYKECTQKGIQPIIGCECYIAPGSRFDKKKE 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62184719    87 KKSRVAHHLILLCKNELGYRNLCLLSSLAFTEGFYYFPRIDRELLSQHAEGLICLSACLSSSVAQAALESE-EALEKDLR 165
gi 46446023    84 YGQRAAYHLTLLAQNNRGYQNLAKLSSSGYIEGFYYYPRVDHDLLRKHSEGLICLSGSLGTLLAHEILQGNvKSIQDHLL 163
gi 15835446    81 RKSQVANHLILLCKDEEGYRNLCLLSSLAYTEGFYYFPRIDRELLKQHSKGLICLSACLSGSIAQAALESE-EALEKDLL 159
gi 76789282    81 RKSRVANHLILLCKDEEGYRNLCLLSSLAYTEGFYYVPRIDRDLLSQHSKGLICLSACLSGSVAQAALESE-EDLEKDLL 159
gi 15605274    81 RKSRVANHLILLCKDEEGYRNLCLLSSLAYTEGFYYVPRIDRDLLSQHSKGLICLSACLSGSVAQAALESE-EDLEKDLL 159
gi 166154760   81 RKSRVANHLILLCKDEEGYRNLCLLSSLAYTEGFYYVPRIDRDLLSQHSKGLICLSACLSGSVAQAALESE-EDLEKDLL 159
gi 166155635   81 RKSRVANHLILLCKDEEGYRNLCLLSSLAYTEGFYYVPRIDRDLLSQHSKGLICLSACLSGSVAQAALESE-EDLEKDLL 159
gi 29839841    81 RKSRVANHLILLCKNEQGYRNLCLLSSLAFTEGFYYFPRIDRELLSQHSEGLVCLSACLSGSVAQAALESE-EALEKDLL 159
gi 89898738    81 KKSRVANHLILLCKNEQGYRNLCLLSSLAFTEGFYYFPRIDRELLSQYSEGLVCLSACLSGSVAQAALESE-EALEKDLR 159
gi 16752374    81 KRSRAAHHLILLCKNEQGYRNLCILTSLAFTEGFYYFPRIDKDLLRQYSEGLICLSGCLSSSVSDAALKSP-EALLLELQ 159
gi 15618576    81 KRSRAAHHLILLCKNEQGYRNLCILTSLAFTEGFYYFPRIDKDLLRQYSEGLICLSGCLSSSVSDAALKSP-EALLLELQ 159
gi 15836198    81 KRSRAAHHLILLCKNEQGYRNLCILTSLAFTEGFYYFPRIDKDLLRQYSEGLICLSGCLSSSVSDAALKSP-EALLLELQ 159
gi 33242023    81 KRSRAAHHLILLCKNEQGYRNLCILTSLAFTEGFYYFPRIDKDLLRQYSEGLICLSGCLSSSVSDAALKSP-EALLLELQ 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62184719   166 WYQNLFGEDFYSEIQLHKMSEEKI---ASLGEEWLKHEYYQFIDSQTKVNQAVLDASKRLGIRSVATNDIHYIHADDWLA 242
gi 46446023   164 WYQEVFKDRFYLDLQRHEMAAEDIqqdGLYQESWLVQQYQDYFNRQQKVNEALIALSREHHIPLVATNDVHYIDREDWRA 243
gi 15835446   160 WYQDLFQEDFFSEVQLHKSSEEKI---ALFEEEWLRQNYYQFIEKQLKVKDAVLTVSKRLGISSVATNDIHYLDPDDWLA 236
gi 76789282   160 WYQDLFQEDFFSEVQLHKSSEEKV---ALFEEAWLKQNYYQFIEKQLKVNEAVLATSKRLGIPSVATNDIHYLNPDDWLA 236
gi 15605274   160 WYQDLFQEDFFSEVQLHKSSEEKV---ALFEETWLKQNYYQFIEKQLKVNEAVLATSKRLGIPSVATNDIHYLNPDDWLA 236
gi 166154760  160 WYQDLFQEDFFSEVQLHKSSEEKV---ALFEEAWLKQNYYQFIEKQLKVNEAVLATSKRLGIPSVATNDIHYLNPDDWLA 236
gi 166155635  160 WYQDLFQEDFFSEVQLHKSSEEKV---ALFEEAWLKQNYYQFIEKQLKVNEAVLATSKRLGIPSVATNDIHYLNPDDWLA 236
gi 29839841   160 WYQNLFGDDFYSEIQLHKMSEEKI---ASLGEEWLKHEYHQFIEAQIKVNQAVLATSRRLGIRSVATNDIHYIHPNDWLA 236
gi 89898738   160 WYQSLFGEDFYSEVQLHKMSEEKI---ASLGEEWLKHEYHQFIETQTKVNQAVLETSKRLGIRSVATNDIHYIHPEDWLA 236
gi 16752374   160 WFQDLFKDDYFTEVQLHKMSEESI---AGFKEEWLKQEYYSLIEKQIKVNTAVLEASKRLGIPTVATNDIHYINANDWQA 236
gi 15618576   160 WFQDLFKDDYFTEVQLHKMSEESI---AGFKEEWLKQEYYSLIEKQIKVNTAVLEASKRLGIPTVATNDIHYINANDWQA 236
gi 15836198   160 WFQDLFKDDYFTEVQLHKMSEESI---AGFKEEWLKQEYYSLIEKQIKVNTAVLEASKRLGIPTVATNDIHYINANDWQA 236
gi 33242023   160 WFQDLFKDDYFTEVQLHKMSEESI---AGFKEEWLKQEYYSLIEKQIKVNTAVLEASKRLGIPTVATNDIHYINANDWQA 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62184719   243 HEILLNVQLGETIRIAKQNTY------IPNPKRKTFRSREYYFKSPEEMARLFADHPETITNTLEVADKCNLHLNLSSKH 316
gi 46446023   244 HEILLNIQSGEPCEIWEKDAYgtpkfrIPNPKRQTYPSHEYYFKSSQQMEQLFKDVPEAIINTQKIAEQCLVEIDFKTKH 323
gi 15835446   237 HEILLNVQSREPIRTAKQNTY------VPNPKRKTYPSREFYFKSPQEMAELFADHPETISNTLIVADRCNLELDFVTKH 310
gi 76789282   237 HEILLNVQSREPIRTAKQNTY------IPNPKRKTYPSREFYFKSPQGMAELFAAHPETITNTCIVAERCHLELDFETKH 310
gi 15605274   237 HEILLNVQSREPIRTAKQNTY------IPNPKRKTYPSREFYFKSPQEIAELFAAHPETITNTCIVAERCHLELDFETKH 310
gi 166154760  237 HEVLLNVQSREPIRTAKQNTY------IPNPKRKTYPSREFYFKSPQEMAELFAAHPETITNTCIVAERCHLELDFETKH 310
gi 166155635  237 HEVLLNVQSREPIRTAKQNTY------IPNPKRKTYPSREFYFKSPQEMAELFAAHPETITNTCIVAERCHLELDFETKH 310
gi 29839841   237 HEILLNVQIGETIRIAKQNTY------IPNPKRKAFRSREYYFKSPEEMALLFADHPETISNTLEVADKCNLSLNLSSKH 310
gi 89898738   237 HEILLNVQLGETIRIAKQNTY------IPNPKRKAFRSREYYFKSPKEMANLFADHPETISNTLEVADKCNLKLDFSVKH 310
gi 16752374   237 HEILLNVQSGETVRIAKQNTH------IPNPKRKVYRSREYYFKSPAQMAELFKDIPEVISNTLEVAKRCDFTFDFSKKH 310
gi 15618576   237 HEILLNVQSGETVRIAKQNTH------IPNPKRKVYRSREYYFKSPAQMAELFKDIPEVISNTLEVAKRCDFTFDFSKKH 310
gi 15836198   237 HEILLNVQSGETVRIAKQNTH------IPNPKRKVYRSREYYFKSPAQMAELFKDIPEVISNTLEVAKRCDFTFDFSKKH 310
gi 33242023   237 HEILLNVQSGETVRIAKQNTH------IPNPKRKVYRSREYYFKSPAQMAELFKDIPEVISNTLEVAKRCDFTFDFSKKH 310
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62184719   317 YPIYVPEFLKSKqNYTEEERYAASAAFLRELCEKGLSTKYTPEKLAHISKKFPDRDPLELVKERLEMEMSIIIPKGMCDY 396
gi 46446023   324 YPVYLPPSLENR-PFEKDEQKKEVENYLWKLCEEGISNRYTIERLAKVQEIYPDRNPLDVVRERLNYEMSIIVPKGMSDY 402
gi 15835446   311 YPIYVPEDLQKKgSYSEEERYNASSAFLEQLCEQGLKTKYTPELLGHIAQKFPEKDPLTVVKERLSLESTIIISKGMCDY 390
gi 76789282   311 YPIYVPEALQKKgSYTEEERYKASSAFLEELCEQGLTSKYTPELLGHIAKKFPGEDPLTLVKERLKLESSIIISKGMCDY 390
gi 15605274   311 YPIYVPEALQKKgSYTEEERYKASSAFLEELCEQGLTSKYTPELLGHIAKKFPGEDPLTLVKERLKLESSIIISKGMCDY 390
gi 166154760  311 YPIYVPEALQKKgSYTEEERYKASSAFLEELCEQGLTSKYTPELLGHIAKKFPGEDPLTLVKERLKLESSIIISKGMCDY 390
gi 166155635  311 YPIYVPEALQKKgSYTEEERYKASSAFLEELCEQGLTSKYTPELLGHIAKKFPGEDPLTLVKERLKLESSIIISKGMCDY 390
gi 29839841   311 YPIYVPEFLKEKqTYTEEERYAASSTFLRELCEQGLFTKYTAEQLAHISKKFPDRDPLELVKERLEMEMSIIIPKGMCDY 390
gi 89898738   311 YPIYVPEFLKEKqTYTEEERYTASSAFLRELCEKGLL-KYTPDKLAHISKKFPNRDPLELVKERMEMEMSIIIPKGMCDY 389
gi 16752374   311 YPIYVPESLKTLnSYTEEDRYQASAVFLKQLAEEALPKKYSSEVLAHIAKKFPHRDPIDIVKERMDMEMAIIIPKGMCDY 390
gi 15618576   311 YPIYVPESLKTLnSYTEEDRYQASAVFLKQLAEEALPKKYSSEVLAHIAKKFPHRDPIDIVKERMDMEMAIIIPKGMCDY 390
gi 15836198   311 YPIYVPESLKTLnSYTEEDRYQASAVFLKQLAEEALPKKYSSEVLAHIAKKFPHRDPIDIVKERMDMEMAIIIPKGMCDY 390
gi 33242023   311 YPIYVPESLKTLnSYTEEDRYQASAVFLKQLAEEALPKKYSSEVLAHIAKKFPHRDPIDIVKERMDMEMAIIIPKGMCDY 390
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62184719   397 LLIVWDIIYWAKDNGIPVGPGRGSGAGSVMLFLLGITEIEPIRFDLFFERFINPERLSYPDIDIDICMAGRERVINYAIE 476
gi 46446023   403 LLIVWDFINWAKRNGIPMGPGRGSGAGSIVLYLIGITDIEPLRFHLFFERFINPERISYPDIDVDICMDRRGEVIAYTLQ 482
gi 15835446   391 LLIVWDIINWAKDHGIPVGPGRGSGAGSVMLFLLGITEIEPIRFDLFFERFINPERLSYPDIDIDICMIGREKVINYAIE 470
gi 76789282   391 LLIVWDIINWAKDHGIPVGPGRGSGAGSVMLFLLGITEIEPIRFDLFFERFINPERISYPDIDIDICMIGRERVINYAIE 470
gi 15605274   391 LLIVWDIINWAKDHGIPVGPGRGSGAGSVMLFLLGITEIEPIRFDLFFERFINPERISYPDIDIDICMIGRERVINYAIE 470
gi 166154760  391 LLIVWDIINWAKDHGIPVGPGRGSGAGSVMLFLLGITEIEPIRFDLFFERFINPERISYPDIDIDICMIGRERVINYAIE 470
gi 166155635  391 LLIVWDIINWAKDHGIPVGPGRGSGAGSVMLFLLGITEIEPIRFDLFFERFINPERISYPDIDIDICMIGRERVINYAIE 470
gi 29839841   391 LLIVWDIIRWAKDNGIPVGPGRGSGAGSVMLFLLGITEIEPIRFDLFFERFINPERLSYPDIDIDICMAGRERVINYAIE 470
gi 89898738   390 LLIVWDIIHWAKAHGIPVGPGRGSGAGSVMLFLLGITEIEPIRFDLFFERFINPERLSYPDIDIDICMAGRERVINYAIE 469
gi 16752374   391 LLIVWDIIHWAKANGIPVGPGRGSGAGSVLLFLLGITEIEPIRFDLFFERFINPERLSYPDIDIDICMAGRERVINYAIE 470
gi 15618576   391 LLIVWDIIHWAKANGIPVGPGRGSGAGSVLLFLLGITEIEPIRFDLFFERFINPERLSYPDIDIDICMAGRERVINYAIE 470
gi 15836198   391 LLIVWDIIHWAKANGIPVGPGRGSGAGSVLLFLLGITEIEPIRFDLFFERFINPERLSYPDIDIDICMAGRERVINYAIE 470
gi 33242023   391 LLIVWDIIHWAKANGIPVGPGRGSGAGSVLLFLLGITEIEPIRFDLFFERFINPERLSYPDIDIDICMAGRERVINYAIE 470
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62184719   477 RHGKDNVAQIITFGTMKAKMAVKDVGRTLDVPLSKVNHIAKHIP-ELNTTLAKALETDPHLNELYTNDAEAAQVIDMAMR 555
gi 46446023   483 KYGKDNVAQIITFGTMKAKMALKDVGRVLSVPLSKVNEIAKLVPeDLNITLDKALEKDQDLRQLYENDEEVGRLIDLAKK 562
gi 15835446   471 RHGKENVAQIITFGTMKAKMAIKDVGRTLDTPLSKVNLIAKKIP-DLNATIASALESDPDLRQLYIDDAEAAEIIDMAKK 549
gi 76789282   471 RHGKDNVAQIITFGTMKAKMAIKDVGRTLDTPLAKVNFIAKHIP-DLNATITSALEADPELRQLYVDDAEAAEVIDMAKK 549
gi 15605274   471 RHGKDNVAQIITFGTMKAKMAIKDVGRTLDTPLAKVNFIAKHIP-DLNATITSALEADPELRQLYVDDAEAAEVIDMAKK 549
gi 166154760  471 RHGKDNVAQIITFGTMKAKMAIKDVGRTLDTPLAKVNFIAKHIP-DLNATITSALEADPELKQLYVDDAEAAEVIDMAKK 549
gi 166155635  471 RHGKDNVAQIITFGTMKAKMAIKDVGRTLDTPLAKVNFIAKHIP-DLNATITSALEADPELKQLYVDDAEAAEVIDMAKK 549
gi 29839841   471 RHGKDNVAQIITFGTMKAKMAVKDVGRTLDVPLSKVNHIAKHIP-EMNTTLAKALETDPHLNELYTNDSEAAQVLDMAMH 549
gi 89898738   470 RHGKNNVAQIITFGTMKAKMAVKDVGRTLDVSLSKVNLIAKHIP-ELNATLSKALETDPHLNQLYADDAEAAQVIDMAMQ 548
gi 16752374   471 RHGKDNVAQIITFGTMKAKMAVKDVGRTLDMALSKVNHIAKHIP-DLNTTLSKALETDPDLHQLYINDAESAQVIDMALC 549
gi 15618576   471 RHGKDNVAQIITFGTMKAKMAVKDVGRTLDMALSKVNHIAKHIP-DLNTTLSKALETDPDLHQLYINDAESAQVIDMALC 549
gi 15836198   471 RHGKDNVAQIITFGTMKAKMAVKDVGRTLDMALSKVNHIAKHIP-DLNTTLSKALETDPDLHQLYINDAESAQVIDMALC 549
gi 33242023   471 RHGKDNVAQIITFGTMKAKMAVKDVGRTLDMALSKVNHIAKHIP-DLNTTLSKALETDPDLHQLYINDAESAQVIDMALC 549
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62184719   556 LEGSIRNTGVHAAGVIICGDRLTNHIPICISKDSTMITTQFSMKPVESVGMLKVDFLGLKTLTSIHIAMRAIEKKTGKLL 635
gi 46446023   563 LEGSIRNTGIHAAGIIISGVPLTNLIPICNSKDSDIPVTQFSMKPVEAVGMLKVDFLGLKTLTAIQICVNAVKASTGKEI 642
gi 15835446   550 LEGSIRNTGVHAAGVIICGDPLTNHIPICVPKDSSMISTQYSMKPVESVGMLKVDFLGLKTLTSIHVATKAIYKKTGILL 629
gi 76789282   550 LEGSIRNTGVHAAGVIICGDPLTNHIPICVPKDSSMISTQYSMKPVESVGMLKVDFLGLKTLTGIHIATQAIYKKTGILL 629
gi 15605274   550 LEGSIRNTGVHAAGVIICGDPLTNHIPICVPKDSSMISTQYSMKPVESVGMLKVDFLGLKTLTGIHIATQAIYKKTGILL 629
gi 166154760  550 LEGSIRNTGVHAAGVIICGDPLTNHIPICVPKDSSMISTQYSMKPVESVGMLKVDFLGLKTLTGIHIATQAIYKKTGILL 629
gi 166155635  550 LEGSIRNTGVHAAGVIICGDPLTNHIPICVPKDSSMISTQYSMKPVESVGMLKVDFLGLKTLTGIHIATQAIYKKTGILL 629
gi 29839841   550 LEGSIRNTGVHAAGVIICGDHLTNHIPICISKDSTMITTQFSMKPVESVGMLKVDFLGLKTLTSIHIAIQAIQKKTGKLL 629
gi 89898738   549 LEGSIRNTGVHAAGVIICGDHLTNHIPICISKDSTMITTQFSMKPVESVGMLKVDFLGLKTLTSIHIAIQAIQKKTGKLL 628
gi 16752374   550 LEGSIRNTGVHAAGVIICGDQLTNHIPICISKDSTMITTQYSMKPVESVGMLKVDLLGLKTLTSINIAMSAIEKKTGQSL 629
gi 15618576   550 LEGSIRNTGVHAAGVIICGDQLTNHIPICISKDSTMITTQYSMKPVESVGMLKVDLLGLKTLTSINIAMSAIEKKTGQSL 629
gi 15836198   550 LEGSIRNTGVHAAGVIICGDQLTNHIPICISKDSTMITTQYSMKPVESVGMLKVDLLGLKTLTSINIAMSAIEKKTGQSL 629
gi 33242023   550 LEGSIRNTGVHAAGVIICGDQLTNHIPICISKDSTMITTQYSMKPVESVGMLKVDLLGLKTLTSINIAMSAIEKKTGQSL 629
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62184719   636 EMASLPLDDKTTFALLHQGKTMGIFQMESKGMQELAKNLRPDSFEEIIAIGALYRPGPMDMIPSFINRKHGKEIIEYDHP 715
gi 46446023   643 DWINLPLDDKPTFDLLNQGKTLGIFQLESGGMQDLARQLHLDRFEEIIAVGALYRPGPMDMIPSFINRKHGREAIENDHP 722
gi 15835446   630 QAATLPLNDRNTFSLLHQGKTMGIFQMESRGMQELAKNLRPDAFEEIIAIGALYRPGPMDMIPSFINRKHGKENIEYDHP 709
gi 76789282   630 RAATIPLDDQNTFSLLHQGKTMGIFQMESRGMQDLAKNLRPDAFEEIIAIGALYRPGPMDMIPSFINRKHGKENIEYDHP 709
gi 15605274   630 RAATIPLDDQNTFSLLHQGKTMGIFQMESRGMQDLAKNLRPDAFEEIIAIGALYRPGPMDMIPSFINRKHGKENIEYDHP 709
gi 166154760  630 RAATIPLDDQNTFSLLHQGKTMGIFQMESRGMQDLAKNLRPDAFEEIIAIGALYRPGPMDMIPSFINRKHGKENIEYDHP 709
gi 166155635  630 RAATIPLDDQNTFSLLHQGKTMGIFQMESRGMQDLAKNLRPDAFEEIIAIGALYRPGPMDMIPSFINRKHGKENIEYDHP 709
gi 29839841   630 EMASLPLDDKTTFALLHQGKTMGIFQMESKGMQELAKNLCPDSFEEIIAIGALYRPGPMDMIPSFISRKHGKEIIEYDHP 709
gi 89898738   629 EMATLPLDDKTTFSLLHQGKTMGIFQMESKGMQELAKNLRPDSFEEIIAIGALYRPGPMDMIPSFINRKHGKEVITYDHP 708
gi 16752374   630 AMATLPLDDATTFSLLHQGKTMGIFQMESKGMQELAKNLRPDLFEEIIAMGALYRPGPMDMIPSFINRKHGKEIIEYDHP 709
gi 15618576   630 AMATLPLDDATTFSLLHQGKTMGIFQMESKGMQELAKNLRPDLFEEIIAMGALYRPGPMDMIPSFINRKHGKEIIEYDHP 709
gi 15836198   630 AMATLPLDDATTFSLLHQGKTMGIFQMESKGMQELAKNLRPDLFEEIIAMGALYRPGPMDMIPSFINRKHGKEIIEYDHP 709
gi 33242023   630 AMATLPLDDATTFSLLHQGKTMGIFQMESKGMQELAKNLRPDLFEEIIAMGALYRPGPMDMIPSFINRKHGKEIIEYDHP 709
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62184719   716 LMESILKETYGIMVYQEQVMQIAGSLASYSLGEGDVLRRAMGKKDIDQMLKERTRFCERARKNGIDAELATTIFDKMEKF 795
gi 46446023   723 WMKDILAETYGIMVYQEQVMQIASKLANFSLGEGDVLRRAMGKKDMDQMAKQREKFRLGALENQIDNQTSMLIFDKMEKF 802
gi 15835446   710 LMEPILKETFGIMVYQEQVMQIAGSLAKYSLGEGDVLRRAMGKKDHEQMVKEREKFCSRASANGIDPSIATTIFDKMEKF 789
gi 76789282   710 LMEPILKETFGIMVYQEQVMQIAGSLAKYSLGEGDVLRRAMGKKDHEQMVKEREKFCSRAAANGIDPSIATTIFDKMEKF 789
gi 15605274   710 LMEPILKETFGIMVYQEQVMQIAGSLAKYSLGEGDVLRRAMGKKDHEQMVKEREKFCSRAAANGIDPSIATTIFDKMEKF 789
gi 166154760  710 LMEPILKETFGIMVYQEQVMQIAGSLAKYSLGEGDVLRRAMGKKDHEQMVKEREKFCSRAAANGIDPSIATTIFDKMEKF 789
gi 166155635  710 LMEPILKETFGIMVYQEQVMQIAGSLAKYSLGEGDVLRRAMGKKDHEQMVKEREKFCSRAAANGIDPSIATTIFDKMEKF 789
gi 29839841   710 LMESILKETYGIMVYQEQVMQIAGSLASYSLGEGDVLRRAMGKKDIQQMLQERTKFCERACKNGIDADLATTIFDKMEKF 789
gi 89898738   709 LIESILKETYGIMVYQEQVMQIAGSLASYSLGEGDVLRRAMGKKDINQMLQERTKFCERACKNGIDADLATTIFDKMEKF 788
gi 16752374   710 LMESILKETYGIMVYQEQVMQIAGALASYSLGEGDVLRRAMGKKDFQQMEQEREKFCKRACNNGIDPELATVIFDKMEKF 789
gi 15618576   710 LMESILKETYGIMVYQEQVMQIAGALASYSLGEGDVLRRAMGKKDFQQMEQEREKFCKRACNNGIDPELATVIFDKMEKF 789
gi 15836198   710 LMESILKETYGIMVYQEQVMQIAGALASYSLGEGDVLRRAMGKKDFQQMEQEREKFCKRACNNGIDPELATVIFDKMEKF 789
gi 33242023   710 LMESILKETYGIMVYQEQVMQIAGALASYSLGEGDVLRRAMGKKDFQQMEQEREKFCKRACNNGIDPELATVIFDKMEKF 789
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62184719   796 ASYGFNKSHAAAYGLITYTTAYLKANYPKEWLAALLTSDSDDIEKIGKLIHEAHSMDICILPPDINESGTDFVATDKGIR 875
gi 46446023   803 AAYGFNKSHAAAYGYLSYVTAYLKANYPGEWMASLMTCDRDDLSKVAKFIRECQSMNIPMLPPDINEAGEIFQATKQGIR 882
gi 15835446   790 ASYGFNKSHAAAYGLITYTTAYLKANYPKEWLAALLTCDYDDIEKVGKLIQEAHSMNIPVLPPDINESGQDFEATQEGIR 869
gi 76789282   790 ASYGFNKSHAAAYGLITYTTAYLKANYPKEWLAALLTCDYDDIEKVGKLIQEAHSMNILVLPPDINESGQDFEATQEGIR 869
gi 15605274   790 ASYGFNKSHAAAYGLITYTTAYLKANYPKEWLAALLTCDYDDIEKVGKLIQEAHSMNILVLPPDINESGQDFEATQKGIR 869
gi 166154760  790 ASYGFNKSHAAAYGLITYTTAYLKANYPKEWLAALLTCDYDDIEKVGKLIQEAHSMNILVLPPDINESGQDFEATQEGIR 869
gi 166155635  790 ASYGFNKSHAAAYGLITYTTAYLKANYPKEWLAALLTCDYDDIEKVGKLIQEAHSMNILVLPPDINESGQDFEATQEGIR 869
gi 29839841   790 ASYGFNKSHAAAYGLITYTTAYLKANYPKEWLAALLTCDSDDIEKVGKLIHEAHSMDICILPPDINESGTNFVATDKGIR 869
gi 89898738   789 ASYGFNKSHAAAYGLITYTTAYLKANYPKEWLAALLTCDSDDIEKVGKLIHEAHSMNICVLPPDINESGTNFVATDKGIR 868
gi 16752374   790 AAYGFNKSHAAAYGLITYTTAYLKANYPKEWLAALLTCDSDDIEKIGKLIREAQSMGIPILPPHINVSSNHFVATDEGIR 869
gi 15618576   790 AAYGFNKSHAAAYGLITYTTAYLKANYPKEWLAALLTCDSDDIEKIGKLIREAQSMGIPILPPHINVSSNHFVATDEGIR 869
gi 15836198   790 AAYGFNKSHAAAYGLITYTTAYLKANYPKEWLAALLTCDSDDIEKIGKLIREAQSMGIPILPPHINVSSNHFVATDEGIR 869
gi 33242023   790 AAYGFNKSHAAAYGLITYTTAYLKANYPKEWLAALLTCDSDDIEKIGKLIREAQSMGIPILPPHINVSSNHFVATDEGIR 869
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62184719   876 FAMGAIRGIGKGLVESIIEEREKHGPYQSIRDFIQRSDLKKVTKKHTENLIDAGCFDVFEPDRDVAQATLESLYDSISKE 955
gi 46446023   883 FAMTGIKGVGAGVVEAIVQERQKRGPFKNFYEFFKRIDTKKVGKKVVESLVEAGSFDFTGWARDALVMSIDPMYESSSKE 962
gi 15835446   870 FSLGAVKGVGVSIVDSIVEEREKNGPYRSLQDFVQRSDFKKVTKKQLESLVDAGSFNCFEPNKDLAIAILNDLYDTFSRE 949
gi 76789282   870 FSLGAVKGVGMSIVDSIVEEREKNGPYKSLQDFVQRADFKKVTKKQLENLVDAGTFDCFEPNKDLALAILNDLYDTFSRE 949
gi 15605274   870 FSLGAVKGVGMSIVDSIVEEREKNGPYKSLQDFVQRADFKKVTKKQLENLVDAGTFDCFEPNKDLALAILNDLYDTFSRE 949
gi 166154760  870 FSLGAVKGVGMSIVDSIVEEREKNGPYKSLQDFVQRADFKKVTKKQLENLVDAGTFDCFEPNKDLALAILNDLYDTFSRE 949
gi 166155635  870 FSLGAVKGVGMSIVDSIVEEREKNGPYKSLQDFVQRADFKKVTKKQLENLVDAGTFDCFEPNKDLALAILNDLYDTFSRE 949
gi 29839841   870 FAMGAIRGIGKGLVESIVEEREKHGPYQSIQDFIQRSDLKKVTKKHTENLIDAGCFDVFESDRDVAQATLETLYDTISKE 949
gi 89898738   869 FAMGAIKGIGKGLVESIIEEREKHGPYQNIQDFLKRSDLKKVTKKHTENLIDAGCFDVFEPDRDVAQAVLESIYESISKE 948
gi 16752374   870 FAMGAIKGIGRGLIESIVEERDHHGPYESIRDFIQRSDLKKVSKKSIESLIDAGCFDCFDSNRDLLLASVEPLYEAIAKD 949
gi 15618576   870 FAMGAIKGIGRGLIESIVEERDHHGPYESIRDFIQRSDLKKVSKKSIESLIDAGCFDCFDSNRDLLLASVEPLYEAIAKD 949
gi 15836198   870 FAMGAIKGIGRGLIESIVEERDHHGPYESIRDFIQRSDLKKVSKKSIESLIDAGCFDCFDSNRDLLLASVEPLYEAIAKD 949
gi 33242023   870 FAMGAIKGIGRGLIESIVEERDHHGPYESIRDFIQRSDLKKVSKKSIESLIDAGCFDCFDSNRDLLLASVEPLYEAIAKD 949
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62184719   956 KKEAATGVMTFFSlnAMHQKHPIPLTPATNVVRRSKK-DILKKEKELLGIYLTEHPMDAVKDILPRLSVVSPGEFANLPH 1034
gi 46446023   963 QKEQAMGFMSLFA--KMDDEMTNQFRKPPEVKNKTSRqDLLRKEKALLGFFLTGHPMDEYKDILQRLSCVPLRRLDQLNH 1040
gi 15835446   950 KKEAATGVLTFFSlnSMTKDPVKVTISPENIVRRSDK-ELLKREKELLGVYLTAHPMDAVKHLLPFLSVVQSKDFEGLPH 1028
gi 76789282   950 KKEAATGVLTFFSldSMARDPVKITVSPENVIQRSPK-ELLKREKELLGVYLTAHPMDAVEHMLPFLSVVPARDFEGLPH 1028
gi 15605274   950 KKEAATGVLTFFSldSMARDPVKITVSPENVIQRSPK-ELLKREKELLGVYLTAHPMDAVEHMLPFLSVVPARDFEGLPH 1028
gi 166154760  950 KKEAATGVLTFFSldSMARDPVKITVSPENVIQRSPK-ELLKREKELLGVYLTAHPMDAVEHMLPFLSVVPARDFEGLPH 1028
gi 166155635  950 KKEAATGVLTFFSldSMARDPVKITVSPENVIQRSPK-ELLKREKELLGVYLTAHPMDAVEHMLPFLSVVPARDFEGLPH 1028
gi 29839841   950 KKEAATGVMTFFSlnTMHQEHRVALPPATNVVRRSKK-EILKKEKELLGIYLTEHPMDAVKDILPQLSVVNSGEFENLPH 1028
gi 89898738   949 KKEAATGVMTFFSlnTMLKEQPIVLTPTTHIVRRQKK-EILKKEKELLGIYLTEHPMDAVKDILPRLSVVSPGEFESLPH 1027
gi 16752374   950 KKEAASGVMTFFTlgAMDRKNEVPICLPKDIPTRSKK-ELLKKEKELLGIYLTEHPMDTVRDHLSRLSVVLAGEFENLPH 1028
gi 15618576   950 KKEAASGVMTFFTlgAMDRKNEVPICLPKDIPTRSKK-ELLKKEKELLGIYLTEHPMDTVRDHLSRLSVVLAGEFENLPH 1028
gi 15836198   950 KKEAASGVMTFFTlgAMDRKNEVPICLPKDIPTRSKK-ELLKKEKELLGIYLTEHPMDTVRDHLSRLSVVLAGEFENLPH 1028
gi 33242023   950 KKEAASGVMTFFTlgAMDRKNEVPICLPKDIPTRSKK-ELLKKEKELLGIYLTEHPMDTVRDHLSRLSVVLAGEFENLPH 1028
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62184719  1035 GAVIRTIFIIDKVTTRISSKGQRKFALLRVNDGVDSYELPIWPEMYAEQQDLLEEDRLIYAILSIDKRSESLRLSCRWMR 1114
gi 46446023  1041 DAVFRSAFIVESLQIRIASKSQKKFAILTISDGMERQELPIWPDLFEEKSHLLQENQLLYAVLQIEKKDGEVKLSCRWLD 1120
gi 15835446  1029 GSVVRTVFLIDKVTTKISSVEHKKFALLQVSDEEDSYELPIWSDMYAEYQDLLEEDRLIYAILTIDRRSDSLRLSCRWMR 1108
gi 76789282  1029 GTIIRTVFLIDKVTTKISSAEQKKFALLQVSDEVDSYELPIWADMYAEYHDLLEEDRLIYAILAIDRRSDSLRLSCRWMR 1108
gi 15605274  1029 GTIIRTVFLIDKVTTKISSAEQKKFALLQVSDEVDSYELPIWADMYAEYRDLLEEDRLIYAILAIDRRSDSLRLSCRWMR 1108
gi 166154760 1029 GTIIRTVFLIDKVTTKISSAEQKKFALLQVSDEVDSYELPIWADMYAEYHDLLEEDRLIYAILAIDRRSDSLRLSCRWMR 1108
gi 166155635 1029 GTIIRTVFLIDKVTTKISSAEQKKFALLQVSDEVDSYELPIWADMYAEYHDLLEEDRLIYAILAIDRRSDSLRLSCRWMR 1108
gi 29839841  1029 GSVIRTIFIIDKVTTRISSKGQRKFALLRVNDGVDSYELPIWPEMYTEQQDLLEEDRLIYAILSIDKRSESLRLSCRWMR 1108
gi 89898738  1028 GAVIRTIFIIDKVTTRISSKGQRKFALLRVNDGVDSYELPIWPEIYAEQQELLEEDRLIYAILSIDKRSESLRLSCRWMK 1107
gi 16752374  1029 GSVVRTVFIIDKVTTKISSKAQKKFAVLRVSDGIDSYELPIWPDMYEEQQELLEEDRLIYAILVLDKRSDSLRISCRWMK 1108
gi 15618576  1029 GSVVRTVFIIDKVTTKISSKAQKKFAVLRVSDGIDSYELPIWPDMYEEQQELLEEDRLIYAILVLDKRSDSLRISCRWMK 1108
gi 15836198  1029 GSVVRTVFIIDKVTTKISSKAQKKFAVLRVSDGIDSYELPIWPDMYEEQQELLEEDRLIYAILVLDKRSDSLRISCRWMK 1108
gi 33242023  1029 GSVVRTVFIIDKVTTKISSKAQKKFAVLRVSDGIDSYELPIWPDMYEEQQELLEEDRLIYAILVLDKRSDSLRISCRWMK 1108
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62184719  1115 DLSLINEDLIQECDDMFDKIKSQMQKMSYLNL-ETNKDTNQGKTStmSKSTDHRSQAPIVKLSLDLEQLRHSHLCTLKQI 1193
gi 46446023  1121 DLTKANEEMIETCDRAYDKAKHQAVRFAQNKNiATKQSEKPKAEKniVKQNQEASSMKTVCIKLNADQARLSHILKIKKL 1200
gi 15835446  1109 DLSSVNDTVITECDEVYDRLKNQK-----IYS-STKKSTGGQSQA--MVKKEEPKAIPPVTISLDLNRLRHSHLFTLKGL 1180
gi 76789282  1109 DLSTVNDSVIAECNEVYDRLKSQK-----VYS-STKKSTGAQSSA--MIKKVETREISPVTISLDLNKLRHSHLFILKGL 1180
gi 15605274  1109 DLSTVNDSVIAECDEVYDRLKSQK-----VYS-STKKSTGAQSSA--MIKKVETREISPVTISLDLNKLRHSHLFILKGL 1180
gi 166154760 1109 DLSTVNDSVIAECDEVYDRLKSQK-----VYS-STKKSTGAQSSA--MIKKVETREISPVTISLDLNKLRHSHLFILKGL 1180
gi 166155635 1109 DLSTVNDSVIAECDEVYDRLKSQK-----VYS-STKKSTGAQSSA--MIKKVETREISPVTISLDLNKLRHSHLFILKGL 1180
gi 29839841  1109 DLSLINQELIQECDDMFDKIKGQMQKMSYLNL-ETNKDTNQRKTStmSKATDNRSQASIVKLSLDLGQLRHSHLCVLKQI 1187
gi 89898738  1108 DLSLVNEDLLKECDDMFDKIKSQMQKMSYLNS-ETLKDSNQRKTPtmSKTTDNGSPVSTVKLSLDLGQLRHSHLCMLKQI 1186
gi 16752374  1109 DLSIVNENIIYECDQAFDRIKNQVQKMSFTMS-TSGKETKAKGNK--PNENGHTQALAPVTLSLDLNELRHSHLCILKKI 1185
gi 15618576  1109 DLSIVNENIIYECDQAFDRIKNQVQKMSFTMS-TSGKETKAKGNK--PNENGHTQALAPVTLSLDLNELRHSHLCILKKI 1185
gi 15836198  1109 DLSIVNENIIYECDQAFDRIKNQVQKMSFTMS-TSGKETKAKGNK--PNENGHTQALAPVTLSLDLNELRHSHLCILKKI 1185
gi 33242023  1109 DLSIVNENIIYECDQAFDRIKNQVQKMSFTMS-TSGKETKAKGNK--PNENGHTQALAPVTLSLDLNELRHSHLCILKKI 1185
                        1210      1220      1230      1240      1250
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 62184719  1194 IRKYPGSRTLSLVFTKNNERVATISPDADYFVSEDtSGLQKDLenSQLPVRFIAV 1248
gi 46446023  1201 IQDHHGTTSVLIDFHNSTKSLATLHIDAKWGITLS-EQFKQKI--CELPCVFEIE 1252
gi 15835446  1181 IRKYSGSRALSLVFTKDNQRIASISPDSDFFVTEDiSAFLQEIetTDIPARILAT 1235
gi 76789282  1181 IRKYSGSQALSLVFTKDNQRFASISPDADFFVTDDiSSLLQEIeaTNIPARVLAT 1235
gi 15605274  1181 IRKYSGSQALSLVFTKDNQRFASISPDADFFVTDDiSSLLQEIeaTNIPARVLAT 1235
gi 166154760 1181 IRKYSGSQALSLVFTKDNQRFASISPDADFFVTDDiSSLLQEIeaTNIPARVLAT 1235
gi 166155635 1181 IRKYSGSQALSLVFTKDNQRFASISPDADFFVTDDiSSLLQEIeaTNIPARVLAT 1235
gi 29839841  1188 IRKYPGPRTLSLVFTKDNERIASISPDTDYFVSNDtSDLQKDLenSQLPVRFIAV 1242
gi 89898738  1187 IRKYPGSRTLSLVFTQNNERVATISPDADYFVSDDiSGLQKELesSQLPVRLVAV 1241
gi 16752374  1186 VQKHPGSRTLVLVFTQDNERVASMSPDDAYFVCEDiEELRQELvtADLPVRVITV 1240
gi 15618576  1186 VQKHPGSRTLVLVFTQDNERVASMSPDDAYFVCEDiEELRQELvtADLPVRVITV 1240
gi 15836198  1186 VQKHPGSRTLVLVFTQDNERVASMSPDDAYFVCEDiEELRQELvtADLPVRVITV 1240
gi 33242023  1186 VQKHPGSRTLVLVFTQDNERVASMSPDDAYFVCEDiEELRQELvtADLPVRVITV 1240
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap