Conserved Protein Domain Family
PRK06309

?
PRK06309: PRK06309 
DNA polymerase III subunit epsilon; Validated
Statistics
?
PSSM-Id: 180524
View PSSM: PRK06309
Aligned: 16 rows
Threshold Bit Score: 364.902
Threshold Setting Gi: 46446795
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604982    1 MPALIFYDTETTGTQIDKDRIVELAAYNGTTSESFQTLVNPEIPIPAEATKIHGITTAEVADAPRFPEAYQKFIEFCGTD 80
gi 237802684   1 MPALIFYDTETTGTQIDKDRIVELAAYNGTTSESFQTLVNPEIPIPAEATKIHGITTAEVADAPRFPEAYQKFIEFCGTD 80
gi 237804606   1 MPALIFYDTETTGTQIDKDRIVELAAYNGTTSESFQTLVNPEIPIPAEATKIHGITTAEVADAPRFPEAYQKFIEFCGTD 80
gi 62185003    1 MTTLIFYDTETTGTQIDKDRIIEIAAYNHITKESFVTYVNPEIPIPEEASKIHGITTSTVISAPKFPEAYKHFCEFCGND 80
gi 89898431    1 MTALIFYDTETTGTQIDKDRIIEIAAFNNVTKESFVTYVNPKIPIPEEASKIHGITTSTVASAPDFPEAYKQFRDFCGNE 80
gi 29840147    1 MTALIFYDTETTGTQIDKDRIIEIAAYNNVTKQSFVTYVNPEIPIPEEASKIHGITTSTVSSAPKFPEAYKQFCDFCGNE 80
gi 16752629    6 MDVLIFYDTETTGTQIERDRIIEIAAYNSVTDESFLTYVNPEIPIPDEASKIHGITTDAVLSAPKFPEAYEGFRKFCGED 85
gi 15618325    6 MDVLIFYDTETTGTQIERDRIIEIAAYNSVTDESFLTYVNPEIPIPDEASKIHGITTDAVLSAPKFPEAYEGFRKFCGED 85
gi 15835943    6 MDVLIFYDTETTGTQIERDRIIEIAAYNSVTDESFLTYVNPEIPIPDEASKIHGITTDAVLSAPKFPEAYEGFRKFCGED 85
gi 33241759    1 MDVLIFYDTETTGTQIERDRIIEIAAYNSVTDESFLTYVNPEIPIPDEASKIHGITTDAVLSAPKFPEAYEGFRKFCGED 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15604982   81 NILVAHNNNAFDYPLLVRECRRHGLSEPQLRTIDSLKWAKKYRTDLPQHSLQYLRQVYGFEENQAHRALDDVITLYRVFS 160
gi 237802684  81 NILVAHNNNAFDYPLLVRECRRHGLSEPQLRTIDSLKWAKKYRTDLPQHSLQYLRQVYGFEENQAHRALDDVITLYRVFS 160
gi 237804606  81 NILVAHNNNAFDYPLLVRECRRHGLSEPQLRTIDSLKWAKKYRTDLPQHSLQYLRQVYGFEENQAHRALDDVITLYRVFS 160
gi 62185003   81 AVLVAHNNDSFDFPLMEKECRRHALEPLSLKTIDSLKWAQKYRPDLPKHNLQYLRQVYGFAENQAHRALDDVITLHNVFS 160
gi 89898431   81 AVLVAHNNDGFDFPLLEKECRRHSLEPLTLRTIDSLKWAQKYRPDLPKHNLQYLRQVYGFAENQAHRALDDVITLHDVFS 160
gi 29840147   81 AILVAHNNDSFDFPLLEKECRRHSLEPLSLRTIDSLKWAQKYRPDLPKHNLQYLRQVYGFAENQAHRALDDVITLYNVFS 160
gi 16752629   86 SILVAHNNDGFDFPLLGKECRRHSLEPLTNRTIDSLKWAQKYRPDLPKHNLQYLRQVYGFAENQAHRALDDVVILHKVFT 165
gi 15618325   86 SILVAHNNDGFDFPLLGKECRRHSLEPLTNRTIDSLKWAQKYRPDLPKHNLQYLRQVYGFAENQAHRALDDVVILHKVFT 165
gi 15835943   86 SILVAHNNDGFDFPLLGKECRRHSLEPLTNRTIDSLKWAQKYRPDLPKHNLQYLRQVYGFAENQAHRALDDVVILHKVFT 165
gi 33241759   81 SILVAHNNDGFDFPLLGKECRRHSLEPLTNRTIDSLKWAQKYRPDLPKHNLQYLRQVYGFAENQAHRALDDVVILHKVFT 160
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 15604982  161 ALVGDLSPDQIYDLLNETCHPRIFKMPFGKYKGKPLSEVPSSYIAWLQKGDYLLQPENKEIKAAIEAYQQLK 232
gi 237802684 161 ALVGDLSPDQIYDLLNETCHPRIFKMPFGKYKGKPLSEVPSSYIAWLQKGDYLLQPENKEIKAAIEAYQQLK 232
gi 237804606 161 ALVGDLSPDQIYDLLNETCHPRIFKMPFGKYKGKPLSEVPSSYIAWLQKGDYLLQPENKEIKAAIEAYQQLK 232
gi 62185003  161 ALIGDLSAEQVLALMEESYHPKTFKMPFGKYKGKPLSEVPPSYIQWLENQGNL----DKDMKAAIDLMKQLT 228
gi 89898431  161 ALIGDLSAEQVLALMEESCHPKTFKMPFGKYKGKPLTEVPASYIQWLENQGNL----DKDMKAAIDLMKQMT 228
gi 29840147  161 ALIGDLSAEQVLALMEESQHPKAFKMPFGKYRGKPLTEVPASYIQWLENQGNL----DKDMKAAIDLMKQMT 228
gi 16752629  166 SLIGDLPPQQVLDLLQQSYHPKVFKMPFGKYKGQPLVDIPKSYFEWLENQGALDKPENKDIKAAIALLHQPT 237
gi 15618325  166 SLIGDLPPQQVLDLLQQSYHPKVFKMPFGKYKGQPLVDIPKSYFEWLENQGALDKPENKDIKAAIALLHQPT 237
gi 15835943  166 SLIGDLPPQQVLDLLQQSYHPKVFKMPFGKYKGQPLVDIPKSYFEWLENQGALDKPENKDIKAAIALLHQPT 237
gi 33241759  161 SLIGDLPPQQVLDLLQQSYHPKVFKMPFGKYKGQPLVDIPKSYFEWLENQGALDKPENKDIKAAIALLHQPT 232
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap