Conserved Protein Domain Family
PRK06289

?
PRK06289: PRK06289 
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 235771
View PSSM: PRK06289
Aligned: 30 rows
Threshold Bit Score: 585.884
Threshold Setting Gi: 300788785
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116326993   4 KIYVLGGEQTDFQRNWTKEGKTFMSLMREAVQDGLAAVGITPDEIkklNKqnrigIFVGNFDAEQYATQGHLGAFLTEVD 83 
167645235   1 MVYILGGWQSDFSANWARQGMTLADAFSQAVGEGLAAVDLDPEDI---DT-----GHVGNFAAELFAGQGLLGGFFGLVH 72 
295688280   1 MVYVLGGWQSDFAANWAREGKELADAFAEAVGQGLAAVDLDPEDV---ET-----GHVGNFAAELFAGQGLLGGMFGLVH 72 
16127341    1 MVYVLGGWQSDFAANWSREGRELADAFAEAVGEGLAAVDLDPEDV---ET-----GHVGNFAAELFAGQGHLGGMFGLVH 72 
221236145   1 MVYVLGGWQSDFAANWSREGRELADAFAEAVGEGLAAVDLDPEDV---ET-----GHVGNFAAELFAGQGHLGGMFGLVH 72 
116332341   4 KIYVLGGEQTDFQRNWTKEGKTFMSLMREAVQDGLAAVGITPDEIkklNKqnrigIFVGNFDAEQYATQGHLGAFLTEVD 83 
189910136   4 KVFVLGGEQTDFQRNWTKEGKTFMSMMREVLDDALEKVGISYDEIkrlNKenkvaVFVGNFDAEQYANQGHLGAFLTEVN 83 
45659120    4 KIYVLGGEQTDFQRNWTKEGKTFMSLMREAVQDGLEAVGITSDEIkklNKqnrigIFVGNFDAEQYATQGHLGAFLTEVD 83 
24216838    4 KIYVLGGEQTDFQRNWTKEGKTFMSLMREAVQDGLEAVGITSDEIkklNKqnrigIFVGNFDAEQYATQGHLGAFLTEVD 83 
271963086   3 AVHVLGGHQTDFARNWAAEGLGLFDMLRETSLGALEAAGVPASEI---QV-----AHVGNLAGELFAGQAQLGGMIASMD 74 
116326993  84 PAFSGIPGGRFEAACASGSIALDAAATKIRAKDYDVAIVLGIEIMKTVSSSVGGDFLGTAAYYEKEAKGVQFPFPKLFGK 163
167645235  73 PALDGLPTARHEAACASGSVAILAATAEIEAGRYDLACVVGIEQMRNVPGQKAAENLGSAAWVGEEFQDARFLWPRAFSD 152
295688280  73 PAFDGLPTARHEAACASGSVAVLAATAEIEAGRYDLACVVGIEQMRNVPGQKAAENLGSAAWAGHEFQDARFLWPRAFSD 152
16127341   73 PAFDGLPTARHEAACASGSVAILAAAAEIEAGRYDLACVVGVEQMRNVPGQKAAENLGSAAWVGHEFQDARFLWPRAFSD 152
221236145  73 PAFDGLPTARHEAACASGSVAILAAAAEIEAGRYDLACVVGVEQMRNVPGQKAAENLGSAAWVGHEFQDARFLWPRAFSD 152
116332341  84 PAFSGIPGGRFEAACASGSIALDAAATKIRAKDYDVAIVLGIEIMKTVSSSVGGDFLGTAAYYEKEAKGVQFPFPKLFGK 163
189910136  84 PALFGVPGARYEAACASGSVALDAAITHIRAEDYDLAIVLGVEVMKTVSSSVGGDFLGTAAYYDKEAKGVQFPFPKLFGK 163
45659120   84 PAFYGIPGGRFEAACASGSIALDAAATKIRAKDYDVAIVLGIEIMKTVSSSVGGDFLGTAAYYEKEAKGVQFPFPKLFGK 163
24216838   84 PAFYGIPGGRFEAACASGSIALDAAATKIRAKDYDVAIVLGIEIMKTVSSSVGGDFLGTAAYYEKEAKGVQFPFPKLFGK 163
271963086  75 PAWAMLPTSRHEAACASGSMALLAAMADLEAGRYDVALVAGVELMRNVGARQAARHLGSAAWAGREASGADFPWPSLFAE 154
116326993 164 LADVILERYKLPEQRfmgaLAEISRINYDNAKKNPKAQTRSWFMNKEHANaRGGEYNMAVGGRLCITDCSQVTDGAAMVV 243
167645235 153 LADEYDRRYGLKYEH----LMAIAQNNFANGRRNPNAQTRDWRFPPQAFT-ADDVANPVVEGRTRKQDCGQVTDGTAVVF 227
295688280 153 LADEYDRRYGLRYEH----LMGIAEVNFANGRRNPNAQTRSWNFGPEAFT-ADDAANPVVEGRTRKQDCGQVTDGTAVVF 227
16127341  153 LADEYDRRYGLKYEH----LMGIAEVNFANGKRNPNAQTRGWNFGPDAFT-ADEVANPVVEGRTRKQDCGQVTDGSAVIF 227
221236145 153 LADEYDRRYGLKYEH----LMGIAEVNFANGKRNPNAQTRGWNFGPDAFT-ADEVANPVVEGRTRKQDCGQVTDGSAVIF 227
116332341 164 LADVILERYKLPEQRfmgaLAEISRINYDNAKKNPKAQTRSWFMNKEHANaRGGEYNMAVGGRLCITDCSQVTDGAAMVV 243
189910136 164 LADVILERYELKEERfmdaLAEISRINYANAKRNPKAQTRTWFMNKEHAMaRGGANNMAVGGRLCITDCSQVTDGAAVTI 243
45659120  164 LADVILERYKLPEQRfmgaLAEISRINYDNAKRNPKAQTRSWFMNKEHANaRGGEYNMAVGGRLCITDCSQVTDGAAMVV 243
24216838  164 LADVILERYKLPEQRfmgaLAEISRINYDNAKRNPKAQTRSWFMNKEHANaRGGEYNMAVGGRLCITDCSQVTDGAAMVV 243
271963086 155 IADTVDARHGLDSAH----LARIAEINHGNALRNPLAQARSWSFPDGCFG-PDDTLNPVVEGRLRKYDCGRITDGASAVV 229
116326993 244 LANKSYTEEYAKKRgkkinTIPRLKGWGHRVAPITFEAKVAESKGDKYILPWTRQTVKDAYDRAEL--GVKDIDVFETHD 321
167645235 228 LASERRARAYADKRgvpleSLPRIQGWGHRSAPISYARKVEASRGQPYVFPQVRRAIEDARARAGVa-DLSQVHAVEVHD 306
295688280 228 LASAARAKAYADERgialdSIPRIKGWGHRSAPLSYARKVEASRDEPYVFPQVRRAILDARARAGIapDVSGIDAVETHD 307
16127341  228 LASEKRARAYADKRgialeSLPRIKGWGHRSAPLSYARKIEASRDQDYIFPQVRRAILDARARAGIapDVSGLDAVETHD 307
221236145 228 LASEKRARAYADKRgialeSLPRIKGWGHRSAPLSYARKIEASRDQDYIFPQVRRAILDARARAGIapDVSGLDAVETHD 307
116332341 244 LANKSYTEEYAKKRgkkinTIPRLKGWGHRVAPITFEAKVAESKGDKYILPWTRQTVKDAYDRAEL--GVKDIDVFETHD 321
189910136 244 LASKDYTKEYAKKTgrkidDIPRVKGWGHRVAPITFEAKKQESVGDKYILPWTRQTVKDAYKRADL--DVKNIDVFETHD 321
45659120  244 LANKSYTEEYAKKRgkkinTIPRLKGWGHRVAPITFEAKVAESKGDKFILPWTRQTVKDAYDRAEL--GVKDIDVFETHD 321
24216838  244 LANKSYTEEYAKKRgkkinTIPRLKGWGHRVAPITFEAKVAESKGDKFILPWTRQTVKDAYDRAEL--GVKDIDVFETHD 321
271963086 230 LASSRHPAASGR---------PVISGWGHRTAPMLLADKLRLSAGGPYLFPHLRQAALDTYARAGLa-GPGDLDVIETHD 299
116326993 322 CFTSSEYAAISAFGISQPGKEHEAIEEGIIDFKGKKPINPSGGLIGVGHPVGASGVRMMLDLYKQVTGTAGNYQVEGAKN 401
167645235 307 CFTATQYMAIDHLGLTAPGESWKAIEDGSIAMGGRLPINPSGGLIGAGHPVGATGVRMAFDAFKQVTGRAGDCQVEGART 386
295688280 308 CFTATEYMAIDHLGLTAPGESWKAIEAGDIAMGGKLPINPSGGLIGTGHPVGATGARMLLDAWKQTSGQAGDYQVEGART 387
16127341  308 CFTATEYMAIDHLGLTAPGESWKAVENGDIAIGGKLPINPSGGLIGTGHPVGATGVRMVLDAWKQTTGQAGDYQVEGAKT 387
221236145 308 CFTATEYMAIDHLGLTAPGESWKAVENGDIAIGGKLPINPSGGLIGTGHPVGATGVRMVLDAWKQTTGQAGDYQVEGAKT 387
116332341 322 CFTSSEYAAISAFGISQPGKEHEAIEEGIIDFKGKKPINPSGGLIGVGHPVGASGVRMMLDLYKQVTGTAGNYQVEGAKN 401
189910136 322 CFTSSEYAAISAFGISEPGKEHVAIEEGTIDFGGKKPINPSGGLIGVGHPVGASGVRMMLDLYKQVTNTAGDYQVKGAKN 401
45659120  322 CFTSSEYAAISAFGISQPGKEHEAIEEGVIDFKGKKPINPSGGLIGVGHPVGASGVRMMLDLYKQVTGTAGDYQVEGAKN 401
24216838  322 CFTSSEYAAISAFGISQPGKEHEAIEEGVIDFKGKKPINPSGGLIGVGHPVGASGVRMMLDLYKQVTGTAGDYQVEGAKN 401
271963086 300 CFTVTEYVALDHLGLTPPGESWKAVEAGTIDFDGSLPVNPSGGLIGLGHPVGATGVRMMLDACRQVTGTAGECQVPGART 379
116326993 402 GLMLNIGGSATTNVVFIVGK 421
167645235 387 VQTLNIGGSTTTTVSLVVGV 406
295688280 388 VQTLNIGGSTTTTVSFVVGT 407
16127341  388 VQTLNIGGSTTTTVSFVVGT 407
221236145 388 VQTLNIGGSTTTTVSFVVGT 407
116332341 402 GLMLNIGGSATTNVVFIVGK 421
189910136 402 GLMLNIGGSATTNFVFILGK 421
45659120  402 GLMLNIGGSATTNVVFIVGK 421
24216838  402 GLMLNIGGSATTNVVFIVGK 421
271963086 380 ALTLNIGGSCTTVAAFAVTL 399
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap