Conserved Protein Domain Family
PRK06205

?
PRK06205: PRK06205 
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 235741
View PSSM: PRK06205
Aligned: 48 rows
Threshold Bit Score: 654.75
Threshold Setting Gi: 118469356
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
85375234    6 KRRVAICTPLRTPVGRFGGTLAPLDAGKLGAVILKALIERSGIDPTRVDDVVFSQGYGNAEAPAIGHWSWLAADLPMEVP 85 
118465045   1 MRRAAIVAPRRTPVGTFGGSLRPLRAEDLAAHVIRAVVAQSAIDPPVIDDVVFAQSYANSEAPCIGRWAALHAGLPISVP 80 
226362133   1 MRRAALVAPVRTAVGRFGGGLRDVPAEILAAAVIKETVARSGIDPELIEDVAMGQSYANSEAPCIGRWAALEAGLPISVA 80 
111020011   1 MRRAALVAPVRTAVGRFGGALRDVPAETLAATVIKETVARSGIDPILIEDVVMGQSYANSEAPCIGRWAALEAGLPIRVA 80 
121592559   1 MRRAAIVTPVRTPVGTFGGSLRPVPVEELAATTVRAVVERSGIDPARIDDVVMAQSYANSEVPCVGRWAALQAGLPVSVP 80 
222109363   1 MRRAAIVTPVRTPVGTFGGSLRPVPVEELAATTVRAVVERSGIDPARIDDVVMAQSYANSEVPCVGRWAALQAGLPVSVP 80 
170735382   1 MKRAAIVSPVRTPVGAFGGSLRGVSVEALGALVANETIRRAGLDPARIDDVVFAQSYANSETPCVGRWIALQAGLPVEVP 80 
160895641   1 MRRAAIVTPLRTPVGTFGGSLRPVSVEELAATTVRAVVEKSGIDPARIDDVVFAQSYASSETPCVGRWAALQAGLPVTVP 80 
194292272   1 MRRAAIVTPLRTPVGTFGGSLRPVPVEELAATAVRAVVERSGIDPARIDDVVFAQSYANSEVPCVGRWAALQAGLPVEVP 80 
116695312   1 MRRAAIVTPLRTPVGTFGGSLRPVPVEELAATAVRAVVERSGIDPARIDDVVFAQSYANSEVPCVGRWAALQAGLPVEVP 80 
85375234   86 GFQLDRRCGSGVQAVATAAMMVETGMADMVVAGGCESMSNVEHYTTDLRGGVRMGDMTLHDRLTRGRLMSQPIeRFGVIT 165
118465045  81 GQQIDRRCGGGLQAVITAAMMVQTGAADVVLAGGVESMSNIEHYTTTARWGSRSGNQILYDRLDRGREMSQPTwRFGPIS 160
226362133  81 GLQTDRRCGTGLQALVTASMMVQTGAADVVLAGGVESMSNIEHYTTGARWGTRAGSLNLYDRLDRGRERSQPEwRFGKIS 160
111020011  81 GLQTDRRCGTGLQALVTASMMVQTGAADVVLAGGVESMSNIEHYTTGARWGTRAGSLNLYDRLDRGRERSQPEwRFGKIS 160
121592559  81 GMQLDRRCGGGLQAIVTASMMVQSGAADVVIAGGVESMSNIEYYSTDMRWGARSGNVRFYDRLDRGRERSQPVeRFGKIS 160
222109363  81 GMQLDRRCGGGLQAIVTASMMVQSGAADVVIAGGVESMSNIEYYSTDMRWGARSGNVRFYDRLDRGRERSQPVeRFGKIS 160
170735382  81 GMQLDRRCGGGLQALATAAMMVQTGAADVVLAGGVESMSNIEYYSTDMRWGARSGSVQFHDRLARGRERSQPEsRFGYIS 160
160895641  81 GMQLDRRCGGGLQAVATAAMMVQSGAADVVIAGGVESMSNIEYYSTDMRWGARSGNVRFYDRLDRGRERSQPVeRFGKIS 160
194292272  81 GMQLDRRCGGGLQAIVTASMMVQSGAADVVIAGGVESMSNIEYYTTDMRWGARSGNVRFFDRLDRGRERSQPVeRFGKIS 160
116695312  81 GMQLDRRCGGGLQAIVTASMMVQSGAADVVIAGGVESMSNIEYYTTDMRWGARSGNVRFFDRLDRGRERSQPVeRFGKIS 160
85375234  166 GMIETAENLAKDYDITRDQADAYAVRSHRNAAKAWEEGKFADHLVPVEVPQRRADPVTFDHDEGYRADASMESLGKLRAI 245
118465045 161 GMIETAENLAADYGIDRAAADAFAARSHQRAAAAQRSGAFDSEIVAVEAPQRRGDPVVVDRDEGVRPDCTPESLARLRPI 240
226362133 161 GMIETAENVAARCGISREESDAFAADSHAKAHAAWEAGKFDDEVIEVKITDRKGNVSVVARDEGIRPDTTAESLARLRSV 240
111020011 161 GMIETAENVATRCGIGREESDAFAAESHAKAHAAWEAGKFDDEVIEVKITDRKGNVTVVARDEGIRPETTPETLARLRSA 240
121592559 161 GMIETAENLARDYGITREEADAFALRSHQRAAAAWEAGRFADEIVPVQVPQRKGEPVTFARDEGFRADVTPESLGKLRVL 240
222109363 161 GMIETAENLARDYGITREEADAFALRSHQRAAAAWEAGRFADEIVPVQVPQRKGEPVTFARDEGFRPDVTPESLAKLRVL 240
170735382 161 GMIETAENLATDYGISREAADEFALHSHRRAAAAWESGRMADEVVSVTVPQKKGEPLLFSRDEGFRADASMESLGKLRAL 240
160895641 161 GMIETAENLARDYGISREAADAYAVRSHQRAAAAWEAGRFADEIVPVKVPQRKGDPVLFTRDEGFRADATTDSMGKLRVL 240
194292272 161 GMIETAENLARDYGISREAADAFAVRSHQRAAAAWEAGRFDAEIVPVQVPQRKGDPVAFTRDEGFRPQTTLDSLAKLRVL 240
116695312 161 GMIETAENLARDYGISREAADVFAARSHARAAAAWEAGRFDAEVVPVQVPQRKGDPVRFARDEGFRPETTRESLGKLRTL 240
85375234  246 DlkrdPEAIVTAGNASQQNDAAAACLVVAEDKLEEMGLTPSLWFHSWAPAGCDPSRMGIGPVPALERLFARTGMGWDDIG 325
118465045 241 T----SNGTVTAGNSSQQNDAAAACLVVAEDRLGNLGLEPIGYLESWAVVGCEPSRMGIGPVRAVEKLFYKTGVGFDDLA 316
226362133 241 V----KDGVVTAGNASQQNDAASSMLVVAEDRLDELGLEPMGFLTGWAAAGCEPGLMGLGPVAATSKLFSRTGASFDDFT 316
111020011 241 L----KDGVVTAGNASQQNDAASSMLVVAEDQLDELGLEPMGFLTGWSAAGCEPALMGLGPVAATSKLFSRTGASFDDFT 316
121592559 241 M----PNGTVTAGNASQQNDASAACLIVAEDKLAELGLTPMATLVGWAAAGCEPSHMGIGPVPAVKKLLARLNLRIDDMD 316
222109363 241 M----PNGTVTAGNASQQNDASAACLIVAEDKLAELGLTPMATLVGWAAAGCEPSHMGIGPVPAVKKLLARLNLRIDDMD 316
170735382 241 M----PGGTVTAGNSSQQNDAAAACLVVSEDRLEALGLEPMAWFTGWAAAGCEPSRMGIGPVPAVQKLMARTGLSLDQMD 316
160895641 241 M----PNGTVTAGNASQQNDASAACLIVAEDKLAELGLTPMATLVGWAAAGCEPSHMGIGPVPAVKKLLARLNLTLDQMD 316
194292272 241 M----PNGTVTAGNASQQNDASAACLIVAEDKLAELGLTPMASLVGWAAAGCEPSHMGIGPVPAVKKLLARLNLTLDQMD 316
116695312 241 M----PNGTVTAGNASQQNDASAACLIVAEDKLAELCLTPMASLVGWAAAGCEPSHMGIGPVPAVKKLLARLNLTLDQMD 316
85375234  326 LVELNEAFAPQVLAVLKGWGWSEDDsRLdMLNVNGSGISLGHPIGATGGRILADMAAEMHRREVRYGLETMCIGGGQGIA 405
118465045 317 LIEINEAFAVQVLAVLSGWGIKLDD-VDdRLNVNGSGISLGHPIGATGVRILTTMLHELHRRGGGLALETMCIGGGQGLA 395
226362133 317 LVELNEAFACQVLGVLKEWGFDDRD----RLNVNGSGISLGHPIGATGARMTTTALHELRRRGGGKALLTMCIGGGQGMA 392
111020011 317 LIELNEAFACQVLGVLKEWGFEDRD----RLNVNGSGISLGHPIGATGARMTTTALHELRRRGGGKALLTMCIGGGQGMA 392
121592559 317 LVELNEAFACQVLAVLKGWEWQDQDaIAhKLNVNGSGISLGHPIGATGVRILATLLHELQRRKGRYGLETMCIGGGQGIA 396
222109363 317 LVELNEAFACQVLAVLKGWEWRDQDaIAhKLNVNGSGISLGHPIGATGVRILATLLHELQRRKGRYGLETMCIGGGQGIA 396
170735382 317 LVEVNEAFACQVLAVLKGWNWHDTD----RLNVNGSGISLGHPIGATGVRIMTTLLHELTRRKGRYALETMCIGGGQGIA 392
160895641 317 LVELNEAFACQVLSVLKGWEWNDQGaIDhKLNVNGSGISLGHPIGATGVRILATLLHELERRKGRYGLETMCIGGGQGIA 396
194292272 317 LVELNEAFACQVLAVLKGWDWQDQDtIEqKLNVNGSGISLGHPIGATGVRILATLLHELQRRGGRYGLETMCIGGGQGIA 396
116695312 317 LVELNEAFACQVLAVLKGWEWHDQDaIEqKLNVNGSGISLGHPIGATGVRILATLLHELQRRGGRYGLETMCIGGGQGIA 396
85375234  406 AIFERA 411
118465045 396 ALFRGA 401
226362133 393 AIVEGA 398
111020011 393 AIVEGA 398
121592559 397 AVFERV 402
222109363 397 AVFERV 402
170735382 393 AVFERA 398
160895641 397 AVFERV 402
194292272 397 AVFERY 402
116695312 397 AVFERY 402
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap