Conserved Protein Domain Family
PRK06199

?
PRK06199: PRK06199 
ornithine cyclodeaminase; Validated
Statistics
?
PSSM-Id: 235738
View PSSM: PRK06199
Aligned: 23 rows
Threshold Bit Score: 611.714
Threshold Setting Gi: 153011896
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
25028671   10 RIDFLYLNEEDMVAAGVTDSARCVETMEETLILLADGDYRMAGASANSHGAQINFPENPEHEGMPADGPDRRFMAMPAYL 89 
25028256    1 MINFLFLNETDMIDAGVADIASCVDVMEETLVLLAQGDYRMAGQNANSHGAMITFPANPAFDSMPADGPDRRFMAMPAYL 80 
19552794   10 AINFLFLSEPDMIAAGVKDVAQCVDVMEETLVLLAQGDYKMAGLNSNSHGAMITFPENPEFEGMPKDGPDRRFMAMPAYL 89 
62390464   10 AINFLFLSEPDMIAAGVKDVAQCVDVMEETLVLLAQGDYKMAGLNSNSHGAMITFPENPEFEGMPKDGPDRRFMAMPAYL 89 
145295703  10 AINFLFLSEPDMIAAGVKDVAQCVDVMEETLVLLAQGDYKMAGLNSNSHGAMITFPENPEFEGMPKDGPDRRFMAMPAYL 89 
148556664  10 RIDFIYLSEQDMIRAGVTDMAACVDTMEEMFALLYHGDYRMAGPSNNSHGSVVVFPEDSPFPDMPKPTPDRRFMAMPAYL 89 
148554509   6 KIDFIYLSEQDMIRAGVTDMPQCVDTMEEMFGLLYHGDYRMAGANNDSHGAMITFPENSPFPDMPKPTADRRLMAMPAYL 85 
172040956  28 RIDFLYLNEEEMVDAGVTDLAACVETMEETLILLADGDYRMAGASANSHGAQINFPDNPEHEGMPANGPDRRFMAMPAYL 107
238023599   6 KIDFIYLSEQDMIHAGVTDMPACVDTMEEMFGLLYHGDYRMAGANNDSHGAAVFFPEQSPFPDMPKPTADRRFMAMPAYL 85 
288960614   6 RIDFIYLSEQDMVKAGVTDMAACVDTMEDMFVLLHTGDYRMAGANNDSHGAMVVFPENSPFPDMPKPTADRRFMAMPAYL 85 
25028671   90 GGRFRSTGVKWYGSNTENRKKDLPRSIHVFVLNDADTGAPKAIMSANLLSAYRTGAVPGVGVKHLALEDSKTVGIIGPGV 169
25028256   81 GGRFNNTGVKWYGSNAANRTRGLPRSIHTFVLNDTDTGAPKAIMSANLLSAYRTGAVPGVGVKHLAVEHASTLAVIGPGV 160
19552794   90 GGRFKNTGVKWYGSNAENKASGLPRSIHTFVLNDTVTGAPKAIMSANLLSAYRTGAVPGVGVKHLAVADATTLAVVGPGV 169
62390464   90 GGRFKNTGVKWYGSNAENKASGLPRSIHTFVLNDTVTGAPKAIMSANLLSAYRTGAVPGVGVKHLAVADATTLAVVGPGV 169
145295703  90 GGRFKNTGVKWYGSNAENKASGLPRSIHTFVLNDTVTGAPKAIMSANLLSAYRTGAVPGVGVKHLAVADATTLAVVGPGV 169
148556664  90 GGRFRTAGMKWYGSNIANREKGLPRSILMFVLNDADTGAPLAFMSANLLSAYRTGAVPGVGARHLARKDSKVVGILGPGV 169
148554509  86 GGRFRTAGMKWYGSNIANRDKGLPRSILTFVLNDADTSAPLAFMSANLLSAYRTGAIPGVGARHFARKDSKVVGLVGPGV 165
172040956 108 GGRFRNSGVKWYGSNADNRQNDLPRSIHLFILNDAVTGAPLSVMSANLLSAYRTGSVPGVGVKHLAVENAETVGIVGPGV 187
238023599  86 GGRFRTAGMKWYGSNIENRDKGLPRSILTFVLNDADTAAPLAFMSANLLSAYRTGAIPGVGARHLARKDSRIVGIVGPGV 165
288960614  86 GGKYRTAGMKWYGSNIANREKGLPRSILMFILNDADTGAPLAFMSANLLSAYRTGAVPGVGARHLARKDSKVVGVHGPGV 165
25028671  170 MSRTIFDAALSQRPSIEEVKIKGRSPESTQRVAEWFREKYPQLRdVRIVDSEQEAIEGSDIVISGTSTSPDGPSGFPYFK 249
25028256  161 MARTITEACMALRSGITTITVKGRSAGGVAAFTDWVHARWPHVT-VTAAPTVEKAVDGADIVIAATTTDAAGSSAFPYLR 239
19552794  170 MAKTITEACIAERPGITTIKIKGRSERGINAFATWALEKFPEIE-VVAVGSEEDVVKDADIVIAATTTDAAGSSAFPYFK 248
62390464  170 MAKTITEACIAERPGITTIKIKGRSERGINAFATWALEKFPEIE-VVAVGSEEDVVKDADIVIAATTTDAAGSSAFPYFK 248
145295703 170 MAKTITEACIAERPGITTIKIKGRSERGINAFATWALEKFPEIE-VVAVGSEEDVVKDADIVIAATTTDAAGSSAFPYFK 248
148556664 170 MAKTSLSAFMAVCPLIDTVKVKGRGRKSLDAFLAWVAETYPQITtVQVVDTIEEVVRHSDIVTYCQSGAIGDPSIYPVVK 249
148554509 166 MGKTTVMALIAVCPLIDTIKIKGRGKASLDSFLSWLAETFPQVTnVEVVDSIEAVVRGSDIVTYCNSGETGDPSTYPLVK 245
172040956 188 MSRTILGAALTQRPSIKNVKIKGRSAGSTQRAADWIKENYPQLEdVRIVETEEEAIRDSDIVITGTSTSPDGPSGFPYLK 267
238023599 166 MAKTTLMALIAACPMIDTVKIKGRGQASLDSFLSWLAVTFPQVTtVEVVDTVEAVVRGSDIVSYCNSGATGDPSQYPLVK 245
288960614 166 MAKTSLAAFMATCPNIDTLKVQGRGQRSLDSFLSWVRETYPRITtIEVVHDIEAIVRGSDIVTYCASGETGDVSKYPVVK 245
25028671  250 REWIKPGALLLMPAAARLDDDFTTSDeANLVVDYRGLYSEWFHENGPNVTyeDLLGIPGNRWYDMFKEGLIPEEKMVNIG 329
25028256  240 RDWLAPGALLLLPAAARFDDSFLTGD-ARLVVDYMGLYDAWAEEYGDRAY--QLLGIPGTHWHDLIRAGKLDQGRVRQMG 316
19552794  249 KEWLKPGALLLLPAAGRFDDAYLLDD-ARLVVDYMGLYEAWAEEYGPQAY--QLLGIPGTHWYDLALQGKLDLAKISQIG 325
62390464  249 KEWLKPGALLLLPAAGRFDDAYLLDD-ARLVVDYMGLYEAWAEEYGPQAY--QLLGIPGTHWYDLALQGKLDLAKISQIG 325
145295703 249 KEWLKPGALLLLPAAGRFDDAYLLDD-ARLVVDYMGLYEAWAEEYGPQAY--QLLGIPGTHWYDLALQGKLDLAKISQIG 325
148556664 250 REWVSPGTFLSMPSLTNIDEGMESPE-IRKVLDNPGLYDAWHEENPKPVH--NNVPVVGIRFLDLIDEGRMSRDQIEDLG 326
148554509 246 REWVKSGAFLVMPASCQMDEGMEQPD-VRKAVDNTGLYECWFDELPKPAH--NHVPLIGVRFLDMIAEGKMTNGQLEDLG 322
172040956 268 KEYLKPGALLLMPAAARLDDEFVQSDdCRLVVDYTGLYEEWFNENGPDVTyeRLLGIPGNRWWDMKEEGTLPADKLVNIG 347
238023599 246 REWVKPGTYLAMPALCNIDEGMERAE-VRKVVDNAGLYEAWFEELPKPAH--THVPIIGVRFMDMIAEGKMAAEQLEDLG 322
288960614 246 REWVKPGAFLSMPASCEIDAGMERSD-VRKVLDNTGLYEAWFEELPKPAH--VHVPVIGVRFMDMLHEGKISRDELEDLG 322
25028671  330 DIASGKAPGRQNDEQIFCYSIGGMPVEDVAWAHDLYENAVKKGIGTELNLWDTPILK 386
25028256  317 DICEGIMPARLNNEEIILYSVGGMPVEDVAWATQVYENALIKGIGTTVNLWDKPALV 373
19552794  326 DICSGKLPGRTNDEEIILYSVGGMPVEDVAWATQVYENALEKGVGTTLNLWESPALA 382
62390464  326 DICSGKLPGRTNDEEIILYSVGGMPVEDVAWATQVYENALEKGVGTTLNLWESPALA 382
145295703 326 DICSGKLPGRTNDEEIILYSVGGMPVEDVAWATQVYENALEKGIGTTLNLWESPALA 382
148556664 327 KIVAGEAPGRRDDDEIIIMSVGGMPVEDVAWGTVVYRNAVEKGIGVPLNLWDQPVLR 383
148554509 323 KVVAGDAPGRTNDEEIIIMSVGGMPVEDVAWGTVVYRNAIERGIGVTLNLWDEPVLR 379
172040956 348 DIASGKAPGRQNDDEIFCYSIGGMPVEDVAWATDVYENALKKGIGTKLNLWDTPRLT 404
238023599 323 KIVAGQAPGRQNDDEIIIMSVGGMPVEDVAWGTVVYRNAIERGIGVKLNLWDVPVLR 379
288960614 323 AICAGAAPGRRNDEEIIILSVGGMPVEDVAWGTVVYRNAIEKGIGVSLNLWETPVLR 379
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap