Conserved Protein Domain Family
PRK06195

?
PRK06195: PRK06195 
DNA polymerase III subunit epsilon; Validated
Statistics
?
PSSM-Id: 235735
View PSSM: PRK06195
Aligned: 16 rows
Threshold Bit Score: 488.136
Threshold Setting Gi: 32477333
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32477333    1 MDFTAIDFETATRRSDSACQLAAVRVRGGEIVDSACWLIRPRPFVFSPANIQIHGITPGMVREEPEFGELWPEIQSTLGD 80
gi 15894025    1 MKFTAIDFETANEKRNSPCSIGIVVVKDGHVVEKSHHLIRPKEMRFMPINIGIHGIRPAMVEKEPEFDKVWEKIKHYFDD 80
gi 18310383    1 MDFVAIDFETANEKRNSACSIGLTVVKDNKIVEEKYFLIKPCEMRFQPMNIWIHGIRPEDVENERTFNEIWEEIKDYIDG 80
gi 110799993   1 MDFVAIDFETANEKRNSACSIGLTVVKDNKIVEEKYFLIKPCEMRFQPMNIWIHGIRPEDVENERTFNEIWEEIKDYIDG 80
gi 148378258   1 MNFVAIDFETANEKRNSPCSIGIVVVKDGEIVEKVHYLIKPKEMRFMPINIGIHGIRPHMVQDELEFDKIWGKIKGYFNN 80
gi 153933783   1 MNFVAIDFETANEKRNSPCSIGIVVVKDGEIVEKVHYLIKPKEMRFMPINIGIHGIRPHMVQDELEFDKIWGKIKGYFNN 80
gi 153935123   1 MNFVAIDFETANEKRNSPCSIGIVVVKDGEIVEKVHYLIKPKEMRFMPINIGIHGIRPHMVQDELEFDKIWGKIKGYFNN 80
gi 187932792   1 MNFVAIDFETANEKRNSPCSIGIVVVKDGEIIEEVHHLIKPKEMRFMPINIGIHGIRPRMVQDELEFDKVWEKIKHYFNK 80
gi 188588313   1 MNFVAIDFETANEKRNSPCSIGIVVVKDGKIIEEVHHLIKPKEMRFMPINIGIHGIRPRMVQDELEFDKVWEKIKHYFNE 80
gi 226947476   1 MNFVAIDFETANEKRNSPCSIGIVVVKDGEIVEKVHYLIKPKEMRFMPINIGIHGIRPHMVQDELEFDKIWGKIKGYFNN 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32477333   81 DCLIAHNASFDLGVLMACLESHDHPVPDMQYSCTRAIARRTWPQQPRFGLKPLSDWLGIRFRHHDALEDSIACAKIALAA 160
gi 15894025   81 TLVIAHNASFDISVLRKSAELYNIELPEFNYICTMKLARNFYKGIENAKLNTVNNFLGYEFRHHDALYDALACSNIMLSI 160
gi 18310383   81 NLVIAHNAAFDISVLRKTLDFYDIPYPDFEYACTVVMAKNYYKSLPNHKLGTVSEALDFEFSHHHAGEDARACANILLNI 160
gi 110799993  81 NLVIAHNAAFDISVLRKTLDFYDIPYPDFEYACTVVMAKNYYKSLPNHKLGTVSEALGFEFSHHHAGEDARACANILLNI 160
gi 148378258  81 NLVIAHNASFDMSVLRSTLKLYNIKMPSFEYICTMKLSKNFYSNIDNARLNTVNNFLGYKFKHHDALADAMACSNILINI 160
gi 153933783  81 NLVIAHNASFDMSVLRSTLKLYNIKMPSFEYICTMKLSKNFYSNIDNARLNTVNNFLGYKFKYHDALADAMACSNILINI 160
gi 153935123  81 NLVIAHNASFDMSVLRSTLKLYNIKMPSFEYICTMKLSKNFYSNIDNARLNTVNNFLGYKFKYHDALADAMACSNILINI 160
gi 187932792  81 NLVIAHNASFDISVLRNTLELYNLEMPSFQYICTMKLSRNFYSNLDNARLNTVNNFLGYEFKHHDALADAMACSNILLNI 160
gi 188588313  81 NLVIAHNASFDISVLRNTLELYNIEMPSFQYICTMKLSKNFYSNLDNARLNTVNNFLGYEFKHHDALADAMACGNILLNI 160
gi 226947476  81 NLVIAHNASFDMSVLRSTLKLYNIKMPSFEYICTMKLSKNFYSNIDNARLNTVNNFLGYKFKHHDALADAMACSNILINI 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32477333  161 AEDSGATSLETLESKLSLSRGSAGAWGKKgPTSRRASTRRKSSPRRSPSRAPEVAIAGSTmtsstisnstagsasfaiep 240
gi 15894025  161 SKELKCKDITEISKLLGVTVGKVDSKGYK-PSQTKGIAVRTSDRIYFSKKKSAFERLKAD-------------------- 219
gi 18310383  161 CKDLDIESVEELSDKLSIRIGAVYENGYK-SSGRKGECKYSSNLRLKEKKKE-----GEI-------------------- 214
gi 110799993 161 CKDLDIESVEELSDKLAIRIGAVYENGYK-SSGRKGECKYSSNLRLKEKKKE-----GEI-------------------- 214
gi 148378258 161 SKELNSKDINEISKLIGVTLGYVNEDGCK-PSSIKGRILKRSNRQAPRENKKIIESFNFT-------------------- 219
gi 153933783 161 SKELNSKDINEISKLIGVTLGYVNEDGCK-PSSIKGRILKRSNRQAPRENKKIIESFNFT-------------------- 219
gi 153935123 161 SKELNSKDINEISKLIGVTLGYVNEDGCK-PSSIKGRILKRSNRQAPRENKKIIESFNFT-------------------- 219
gi 187932792 161 CEELNTRDINEISKCVGVTLGCVNENGYK-PSSTKGRIFERSSRQPVRQSETTMKNFNFT-------------------- 219
gi 188588313 161 CEELNTRDINEISKCVGVTLGCVNENGYK-PSSTKGRIFERSSRQPVRQSENTMKNFDFT-------------------- 219
gi 226947476 161 SKELNSKDINEISKLIGVTLGYINENGYK-PSSTKGRILKRSNRQSPRENKKIIESFNFT-------------------- 219
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 32477333  241 prpcgisdsgvdlqrlmiradfirPLEGRKVVFTGVLQKLQREEAEMLTSRCGGKCQSSVSRKTDLVVVGDPDSRTVQAS 320
gi 15894025  220 ------------------------EFKNEVVVFTGRLDSMSRDEAMGLVRRLGGTAGSSVTKKTTILVTNMKNIKNLRRE 275
gi 18310383  215 ------------------------SLKCKNVVFTGPLSSMSRGEAIGNVIRCGGFVSSSVSKKTNYLITGIRDLNKLKEN 270
gi 110799993 215 ------------------------SLKCKNVVFTGPLSSMSRGEAIGNVIRCGGFVSSSVSKKTNYLITGIRDLNKLKEN 270
gi 148378258 220 ------------------------AFKEEVVVFTGGLASMTRNEAMILVGKLNGTVGSSVTKKTTYLVTNTKDIEDLNRE 275
gi 153933783 220 ------------------------AFKEEVVVFTGGLASMTRNEAMILVGKLNGTVGSSVTKKTTYLVTNTKDIEDLNRE 275
gi 153935123 220 ------------------------AFKEEVVVFTGGLASMTRNEAMILVGKLNGTVGSSVTKKTTYLVTNTKDIEDLNRE 275
gi 187932792 220 ------------------------AFTDEVVVFTGGLASMTRDEAIRLVRKLNGSVGSSVTKKTTYLVTNTKNIDDLHRD 275
gi 188588313 220 ------------------------AFTDEVVVFTGGLASMTRDEAIRLVRKLGGSVGSSVTKKTTYLVTNTKDIDNLHRD 275
gi 226947476 220 ------------------------AFKEEVVVFTGGLASMTRNEAMILVGKLNGTVGSSVTKKTTYLVTNTKDIEDLNRE 275
                        330       340       350
                 ....*....|....*....|....*....|..
gi 32477333  321 rTMSVKEATARQLAAEGAPLRIMTEHEFLEMI 352
gi 15894025  276 -EMSNKLKRASDLNARGQNIKFLNEEEFLKIK 306
gi 18310383  271 -EKSIKLKKAENLIKENFDIKIINEEEFLSII 301
gi 110799993 271 -EKSIKLKKAENLIKENFDIKIINEEEFLSII 301
gi 148378258 276 -EMSNKLKKAIDLKKKGQNIKFLNEEAFLQKC 306
gi 153933783 276 -EMSNKLKKAIDLKKKGQNIKFLNEEAFLQKC 306
gi 153935123 276 -EMSNKLKKAIDLKKKGQNIKFLNEEAFLQKC 306
gi 187932792 276 -EMSNKLRKAVDLKDKGQGIKFLNEEAFLKKC 306
gi 188588313 276 -EMSTKLRKAVDLKNKGQGIKCLNEGAFLKKC 306
gi 226947476 276 -EMSNKLKKAIDLKKKGQNIKFLNEEAFLQKC 306
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap