Conserved Protein Domain Family
PRK06189

?
PRK06189: PRK06189 
allantoinase; Provisional
Statistics
?
PSSM-Id: 235732
View PSSM: PRK06189
Aligned: 11 rows
Threshold Bit Score: 776.572
Threshold Setting Gi: 15614872
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 251797304   3 QIYDRIIRNGQVVLPEGTYRLDIGIIGGKIATVSE--SLAdSAADEILDAEGKYVLPGMIDMHVHFNEPNFGHWEGFATG 80
gi 15806173    1 MSLDLLLRGAVLVTPEGERRADLGIVGGQIAELTD--EIA-TPAAQTLDVSGLHVFPGVLDDHVHLNEPGRTHWEGFETG 77
gi 94972077    1 -MYDLLVRGGQLVREGGVEQADLGVVEERIVEIAP--ELM-GDAREELDARGLHVFPGAVDIHVHFNEPGRTDWEGIRTG 76
gi 15614872    2 KRFDLIIRSSTVVTETTTYRADVAIRNGIVSAITEpgSIS-SDDGPAIDGTGLHLFPGMVDVHVHFNEPGRTEWEGFASG 80
gi 305675835   1 MAYDMVIKGAKAVTPDGVKEADIAVQNGVITEIGS--DVE-ASGAAIIQADGQYVFPGVIDCHAHFNEPGREDWEGFETG 77
gi 16080294    1 MAYDMVIKGAKAVTPDGVIEADIVVQNGVIAEIGS--DIE-ASGTEIIQADGKYVFPGVIDCHVHFNEPGREDWEGFETG 77
gi 154687351   1 MAYDVIVKGAKAVRKGGTERADIAVKDGKIALIGP--GID-ENAEQVVQADGMYVFPGAVDCHVHFNEPGREEWEGIETG 77
gi 294498817   1 -MYDLIIRDGSVVLEDEIVKADIGIKKGKIAEIVQ--GVS-TPAKKYVDAKGKYVLPGMIDIHVHFDEPSRDHWEGFDYG 76
gi 295704139   1 -MYDLIIRDGSVVLEDEIVKADIGIKKGKIAEIAQ--GVS-IPAKKYVNAKGKYVLPGMIDIHVHFDEPSRDHWEGFDYG 76
gi 297566199   1 MGLDLLVRGGYLVRPEGVARADIGVLDGKIAMIEP--QID-GPARMLIEATGRYVFPGLIDVHVHFNEPGRTHWEGFASG 77
gi 291295772   1 -MLDLIVRTGKLVTPEGVRQADLGIKDGQIAQIAP--EIS-EPARQEVSAEGLHVLPGLIDVHVHFNEPGQAHWEGIATG 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 251797304  81 SSALAAGGCTTYADMPLNGNPPTVTPEALAFKRELAGGNSAVDYTFWGGLVPGKLDQLEKLAAQGVRGFKAFMSNPGGEg 160
gi 15806173   78 TQALAAGGATSFLDMPLNSSPPVLTRERFEDKARLGEEKSLIDFGLWGGLTPLNLDQLDDLAECGVIGLKAFMSHSGLD- 156
gi 94972077   77 SRALVAGGGTVFADMPLNSTPPVLDRTTFEAKQQAAERESYADFALWGGLTPRNLDRLPELAEAGAVGFKAFMSHSGLE- 155
gi 15614872   81 SKSLAAGGVTTYFDMPLNSNPPTITREELDKKRQLANEKSLVDYRFWGGLVPGNIDHLQDLHDGGVIGFKAFMSECGTD- 159
gi 305675835  78 SQMMAAGGCTTYFDMPLNCIPSTVTAEHLLAKAELGRQKSAVDFALWGGLVPGHIDDIRPMAEAGAIGFKAFLSKSGTD- 156
gi 16080294   78 SQMMAAGGCTTYFDMPLNCIPSTVTAEHLLAKAELGRQKSAVDFALWGGLVPGHIEDIRPMAEAGAIGFKAFLSKSGTD- 156
gi 154687351  78 SNMLAAGGCTSYFDMPLNCIPSTVTAENLLAKAEIAERKSAVDFALWGGLMPGYTEHIRPMAEAGAIGFKAFLSKSGTD- 156
gi 294498817  77 SASMAAGGCTTYFDMPLNGVPPTVTEAALWEKKKLADQKSVVDYGLWGGVVPGNKEELAKMAHSGVIGFKAFMSEAGS-- 154
gi 295704139  77 SASMAAGGCTTYFDMPLNGVPPTVTEAALWEKKKLADQKSVVDYGLWGGLVPGNKEELAKMAHSGVIGFKAFMSEAGS-- 154
gi 297566199  78 SAALAAGGGTLFCDMPLNSHPPVLTRREFDDKLGAARAHSHTDFALWGGLTPDNLEHLGELAEAGVMGFKAFMANSGIS- 156
gi 291295772  77 SAALAAGGGTAFFDMPLNSLPCTLDAPSFDQKLAAMRASSHTDFALWGGLTPQNLERLPELALRGVIGFKAFMSNSGLP- 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 251797304 161 egRFREVDDLTLYEGMKKIAALGGFVALHAESDAITSVLAEQAIQEGRTDARAFVASRPVIAELEAVNKAILFSEQTGCE 240
gi 15806173  157 --EFPAADDLTLYEGMRTAKRHGLVVATHAESNEFTRRLTETARAQGKSGVRDYLESRPVVTELEAVQRALLFAQDTGAA 234
gi 94972077  156 --EFESPDDFTLYEGMLQARDLGLIVALHAESDAITRGLSTRIRREGGTGVRDYLRSRPAIAEVEAVNRALLLAEETGAK 233
gi 15614872  160 --DFQFSHDETLLKGMKKIAALGSILAVHAESNEMVNALTTIAIEEQRLTVKDYSEARPIVSELEAVERILRFAQLTCCP 237
gi 305675835 157 --EFRSVDERTLLKGMTEIAAAGKILALHAESDAITSYLQMVLANKGKVDADAYAASRPEEAEAEAVYRTIQYAKVTGCP 234
gi 16080294  157 --EFRSVDERTLLKGMAEIAAAGKILALHAESDAITSYLQMVLANKGKVDADAYAASRPEEAEVEAVYRTIQYAKVTGCP 234
gi 154687351 157 --EFQSADERTLLKGMKEIAACGKVLALHAESDALTRFLEAEYALQGKIDVRAYASSRPEEAECEAVQRAIEYARATGCA 234
gi 294498817 155 --EFDFSDDLTLYEGMKEIAKLNKVLALHAERNDLIQKLEQAKQKQKQTAIKDYLETRPVVAEVNAVKQALEYGEETGCP 232
gi 295704139 155 --EFDFSDDLTLYEGMKEIAKLNKVLALHAERNDLIQKLEQAKQKQKQTAIKDYLETRPVVAEVNAVKQALEYGEETGCP 232
gi 297566199 157 --EFRAADDATLYEGMRLAARLGLPVAVHAENDTLTAHLTRQIRSKGGASARDYLASRPVFTELEAIQRALLLAQETGCR 234
gi 291295772 156 --EFPHCDDGSLYEGMRIAARLGLPVAVHAESDALTAHFARQKQQQGQTTWRDYLDSRPVFTELEAIQRALLLAQETGCR 233
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 251797304 241 VHFVHISSVEAVELIDRAKKRGIPLTVETCPHYLLLTDEDMADIGPAAKCAPPLRGKEQKEGLWRLLAEGKLDVIASDHS 320
gi 15806173  235 LHLVHVSSGAAVALAYEGKQKGIDVTIETCPHYLHFTGEDVERVGAALKCAPPLRDPAVQEELWRELLAGHIDTVGSDHS 314
gi 94972077  234 LHLVHLSTGRAVTLAAEARARGVDVSIETCPHYLCFTGEDMERLGAVLKCAPPLRDASEVDALWQAIRAGHIDTIGSDHS 313
gi 15614872  238 IHICHVSSRKVLKRIKQAKGEGVNVSVETCPHYLLFSLDEFAEIGYLAKCAPPLRERQEVEDLWDGLMAGEIDLISSDHS 317
gi 305675835 235 VHFVHISTAKAVRLIREAKREGLDVSVETCPHYVLFSHDDLREKGSVAKCAPPLRSQSSKEALIDTLIAGNIDMVSSDHS 314
gi 16080294  235 VHFVHISTAKAVRLIREAKQEGLDVSVETCPHYVLFSHDDLRQRGSVAKCAPPLRSRQSKETLIETLIAGDIDMVSSDHS 314
gi 154687351 235 LHFVHISTKRAVLSIQQAKKDGLDVTVETCPHYLLFSFEDFLKKGAAAKCAPPLRSEADKEELIGVLAEGLIDMVSSDHS 314
gi 294498817 233 LHFVHISSYEAVQLITEAKKNGMNVTLETCPHYLLFTEEDFEEIGVTAKCAPPLRSRSQKEKLWACIQSEEVDMISSDHS 312
gi 295704139 233 LHFVHISSYEAVQLITEAKKNGRNVTLETCPHYLLFTEEDFEEIGVTAKCAPPLRSRSQKEKLWACIQSEEIDMISSDHS 312
gi 297566199 235 LHLVHISSGSGVVLAYEAKARGVDVSLETCPHYLAFSEEDLERLGAVLKCAPPVRAREEQELLWNGVLAGKVDLIASDHS 314
gi 291295772 234 LHIVHISSGAGVALAAEAKARGVDVSLETCPHYLAFTEEDLERLGALAKCAPPLRSGDQQTLLWNQVLQGLVDIIGSDHS 313
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 251797304 321 PCPPELKfdESLSFFDAWGGIAGAQSSLELMLDEGFIKRGIPLHKLVDLLSAGPAKRFGLyPQKGQIDVGADADLVLVDA 400
gi 15806173  315 PAPPDMK--TSEDFFSLWGGISGAQSTLNVMLEDGYAQRGLPLEIIAALLALNPAQRFGL-PQKGRLAVGADADFALVAL 391
gi 94972077  314 PSTLDLK--ERADFFEVWGGIAGVQSTLTVLLTEG-RERGLSLPDIARLSARTPAGHFGL-AGKGRLEPGADADLVLVDL 389
gi 15614872  318 PSLPQMK--TGKTIFEVWGGIAGCQNTLAVMLTEGYHKRKMPLTQIVQLLSTEPAKRFGLyPQKGTIQVGAEASFTLIDL 395
gi 305675835 315 PCRPSLK--REDNMFLSWGGISGGQFTLLAMFQLA-FERHIPFETIAEWTAGAPAKRFGI-QQKGRLEEGQDADFVLVSM 390
gi 16080294  315 PCRPSLK--REDNMFLSWGGISGGQFTLLGMLELA-LEHQIPFETIAEWTAAAPAKRFGL-QKKGRLEAGCDADFVLVSM 390
gi 154687351 315 PCHPSLK--REDNMFLSWGGISGGQFTLLGMIQLA-IDHGIPFEHVARWTAEAPAKRFGL-TNKGRLEEGFDADFAIVRP 390
gi 294498817 313 PCPIELKtaHQNDLFKVWGGISGGQYSLQAMISEGAITRGISLSHISKLVSTNPAKRFGLyPKKGSILLGSDADLVIVDL 392
gi 295704139 313 PCPIELKtaHQNDLFKVWGGISGGQYSLQAMISEGAITRGISLSHISKLVSTNPAKRFGLyPKKGSILLGSDADLVIVDL 392
gi 297566199 315 PSSPDLK--EGNDLFAAWGGISGVQSTLPVLLSEGHWARGLSLETISRMTSCHPAQRFGF-AQKGQVAVGFDADLALVDL 391
gi 291295772 314 PSPPEMK--QGDDFFALWGGIAGVQSTLAVLLTEGWQARGLALEQIARLLATNPAQRFGL-QGKGLLAEGYDADFALVDL 390
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 251797304 401 SRTYTLteDQLWQRHKVSPYLGREIACKVTATLVRGIPVYTDEQgVNPVKHGQLLLKPVH 460
gi 15806173  392 GEKFTL--DTLYDRWQQNPYRGQSFQGRVHATYLRGQPVYQNGE-FTGTPRGRLLRPRSL 448
gi 94972077  390 DREWVHtpEDLHTRWKFSPYLGRTFRGRVVQTRLRGQTVYAEGR-FPHPPQGRFLRPAPA 448
gi 15614872  396 NESYTLnaSDLYYRHPISPYVGQRFRGKVKHTICQGKHVYQDH----------------- 438
gi 305675835 391 -EPYTVtrETMFAKHKQSIYEGHTFPCRISATYSRGRCVYSDREkADSGIDGALVVPS-- 447
gi 16080294  391 -EPYTVtrESMFAKHKKSIYEGHTFPCSISATYSKGRCVYNDGE-KVTEIDGALVVPS-- 446
gi 154687351 391 -EPFTVtkETMFSKHKQSLYEGHTFPYRIAATYSKGRCVYQDGGrKQSGAFGTFLKPSEI 449
gi 294498817 393 DQTEKVtkEGMVFKHKHSIYEGTVFNSVILTTINRGTIVYNKEEgVFPLHKGQMVNGEYV 452
gi 295704139 393 DQTEKVtkEGMVFKHKHSIYEGTVFTSVILTTINRGTIVYNKEEgVFPLHKGQMVNGEYV 452
gi 297566199 392 EAEFTLnqDELFYRHPQSPYLGRRFKGRVVHTLVRGQTVFAEGK-LHPELRGQLVRPQVR 450
gi 291295772 391 QQTHTLkpQDLHQRHPISPYLGRRFVGVVRETWLRGQRVYALGK-IEKPNEVRLLTRHL- 448
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap