Conserved Protein Domain Family
PRK06158

?
PRK06158: PRK06158 
thiolase; Provisional
Statistics
?
PSSM-Id: 180434
View PSSM: PRK06158
Aligned: 25 rows
Threshold Bit Score: 636.303
Threshold Setting Gi: 90422587
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
163855947   1 MIDPKLRGAAAIVGVGHAGLG-EAHGYTEMEILVQAAQRAVADAGLTMRDIDGLATASVASTMWAMPVIEHLGIRPTFID 79 
33599754    1 -MSRALRGRAVIAGIGNTHRW-QAPGRTPFDQLQEAAVLALEDCGLAMAQVDGLFCAMSTSGLPVLNVAERLGIRPRHAD 78 
163854685   1 MSIDFRPGRAVIVGAAESDLGaVGDAFSAIDLMAQGVYRALDDCGLSIGDVDGLFCATSQSRLAGLALAEYLNLPEAYID 80 
121592564  13 AVNRPLRGRAAIVGAATYGCG-EAPGMDDMTLLVRAAHAAVADAGLTMQDIDGLATCSVNASMWTMPVIEHLGINPTYVD 91 
222109368  13 AVNRPLRGRAAIVGAATYGCG-EAPGMDDMTLLVRAAHAAVADAGLTMQDIDGLATCSVNASMWTMPVIEHLGINPTYVD 91 
239820446   3 AELKALRGSAAIAGAATFGCG-EAPGFTDMELLARAARAAVADAGLQMRDIDGLCTASASAAMWTLPVVEYLGLNPRYID 81 
160895626  14 AVNRPLRGRVAIAGAATYGCG-EAPGMDDMTLLVRAAHAAVADAGLTMQDIDGLATCSVNASMWTMPVIEHLGINPTYVD 92 
116694542   1 MSLSNLRGSVAIVGVGQAGLG-EAHGKTEMEILVEAAKAAVRDAGLSMRDIDGIATASVGASMWVMPVAEYLGIKPKFVD 79 
94314030    4 ALKATDRGGVAILGTGLAGLG-HAGGRTEQEIIAQAAHRAVAASGLRMADIDGIVTSSLTSPWWVMRMSEYLGIRPRFSD 82 
73537347    1 MSLSSLRGSVAIVGVGQAGLG-EAHGKTEMEILVEAAKAAVKDAGMSMRDIDGIATASVGATMWVMPVAEYLGIKPKFVD 79 
163855947  80 NTMIGGSSFVAHLMPALQALASGQCNAVLVCYGSTQRTSTlnraeiGNARRKLDPQPYENPYNPLSPLSSYALAAARHMH 159
33599754   79 GTMVGGASFLFHLQAAIAALETGLCEVALICYGSNQLTAG------GKLASMPDPQPYEAPFRPRYPMSSYALAAARHMH 152
163854685  81 STSTGGSSFMGHLARAEAAVAAGLCKVAVVAYGSTQRSLG------RKNTSRPEWNPYESPFKPFLPPTAYALAAARHMH 154
121592564  92 GTMIGGSSFIAHLLPAIRALEAGQCKAVLVCYGSAQRSATfgrkesVAARRFLDPQPYEFPYEPVLPVSAYALAAARHMH 171
222109368  92 GTMIGGSSFIAHLLPAIRALEAGQCKAVLVCYGSAQRSATfgrkesVAARRFLDPQPYEFPYEPVLPVSAYALAAARHMH 171
239820446  82 GTMLGGSSFIAHLLPAMQAIRSGQCSAVLICYGSAQRSAAfgrreiVAARRFLDPQPYEHPYEPMLPVSAYALAASRHMH 161
160895626  93 GTMIGGSSFIAHLLPAIRALEAGQCKAVLVCYGSAQRSATfgrkegQAARRFLDPQPYEFPYEPVLPVTAYALAAARHMH 172
116694542  80 STMIGGSSFVSHMLPAMMALESGQCDAVLVCYGSNQRTSTvgragiSKVRAVLDPQPYEHPYSPLQPITSYALAAARHMH 159
94314030   83 STMFGGSSFIADVRIAAMAIEAGECDNVLICYGSNPRSIPsss-rvNAMRAELDPQPYEHPYKPFNPVTSYALAAARHMH 161
73537347   80 STMIGGSSFVSHMLPAMMALEAGLCDAVLVCYGSNQRTSTvgragiSKVRAVLDPQPYENPYQPLSPITSYALAAARHMH 159
163855947 160 QYGTTREQLAEVAVAARKWAQLNPEAFMRDPLTIEDVLASRMVSDPLTVRDSCLVTDGAGAYVLVRADRARDLPHPPVYV 239
33599754  153 QYGTTREQLADVAVAARLWARRNPHAYARDPLARADVLGARMISDPLTKADSCLVTDGGAALVLVRAERAADLPRPPVYV 232
163854685 155 EFGTTREQLAEVAVAARQWALLNPVAWEKDPLTVEEVLASRMVSYPLTIRDCCLVSDGGGAVVVTTPARARSLAKPPVYL 234
121592564 172 EFGTTREQLAEVAVAARAWAQQNPEAFMRDPLTIEDVLAARPIASPLTVRDCCLVTDGGGALVLTRAERARDLPNPPVYV 251
222109368 172 EFGTTREQLAEVAVAARAWAQQNPEAFMRDPLTIEDVLAARPIASPLTVRDCCLVTDGGGALVLTRAERARDLPNPPVYV 251
239820446 162 EFGTTREQLADVAVAARAWAGLNPEAFMREPLTRADVLGARMVSDPLGVRDCCLVTDGAGACVLVSAERARDLPRKPVYV 241
160895626 173 EFGTTREQLAEVAVAARAWAQLNPEAFMRDPLTIEDVLSARPIASPLSVRDCCLVTDGAGAIVLVRGERARDLPRPPVYV 252
116694542 160 QYGTTREHLAEVAVAARKWAQLNPEAMMRDPLSIDDVLNARMVSDPLSVRDCCLVTDGAGAYVMVRADRARDLAKPPVYV 239
94314030  162 EFGTTRTQLAEVAVAARQWAQRNPDAFMRDPLTVDDVINAKMVSDPLTVRDCCLVTDGAGAFVVTRADRARGLHAKPVYV 241
73537347  160 QYGTTREHLAEVAVAARKWAQLNPEAQMRDPLSIEDVLNARMVSDPLSVRDCCLVTDGAGAYVMVRADRAKDMAKPPVYV 239
163855947 240 LGSSTACWNRQISSMDDLTVTAAKQSGAIAFEMAGMGPKDIDVVELYDAFTINPILFLEDLGFCQKGEGGPFVSGGALAP 319
33599754  233 LGTGVAVSHRQISAMPDLTVTCAVESGRRACEMAGVAPRDMDHVMLYDAFTINTLLFLEDLGFCAKGEAGAFVESGAIAP 312
163854685 235 LGSGHCTTHLTISNMPDLVNTGARVSGEMAYAQAGLTSSDIDVVGLYDAFTINPILFLEDLGFCAKGEGGAFVSGGRIAP 314
121592564 252 LGNATAIWNRQISCMPDLTTTAAAQSGAQAFAMAGLQAKDMDMAQVYDAFTINTLLFLEDLGFCAKGEGGAFVQNGGIAP 331
222109368 252 LGNATAIWNRQISCMPDLTTTAAAQSGAQAFAMAGLQAKDMDMAQVYDAFTINTLLFLEDLGFCAKGEAGAFVQNGGIAP 331
239820446 242 LGNATAVWNRQISSMADLTVTAARQSGREAFAMAGLAPADMDVVQLYDAFTINTLLFLEDLGFCPKGEGGRFVADGAIAP 321
160895626 253 LGNATAIWNRQISCMPDLTTTAAAQSGAQAFAMAGLTAADMDMAQVYDAFTINTLLFLEDLGFCAKGEGGAFVSKGGIAP 332
116694542 240 LGNATATWHRQISCMPDLTVTAAKESGERAFAMAGLKPSDVDVAELYDAFTINTLLFLEDLGFCAKGEGGQFVSGGGIAP 319
94314030  242 LGVGHAHWHRQISCMDDLTRTPAIDSGRKAFAQAGLTPADIDVVELYDAFTINPILFLEDLGFCAKGEGGAFISGGRIAP 321
73537347  240 LGNATATWHRQISCMPDVTVTAAKESGERAFAMAGLKPSDVDVAELYDAFTINTLLFLEDLGFCPKGEGGHFVSGGGIAP 319
163855947 320 GGRLAVNTNGGGLSCVHPGMYGMFITIEAVRQLRGQCGERQVAGARTALVHGNGGTLSSQSTAILGTEATL 390
33599754  313 GGSLPVNTNGGGLSCNHPGMYGLFTVIESVAQLRGECGERQVEGARLSMAHANGGVLSSQATVILGTAETL 383
163854685 315 GGTLPVNTNGGGLSYCHPGMYGIFLLIEAVRQLRGECGRRQVDGAEVALAHGNGGVLSSQYTVILGGASTC 385
121592564 332 GGRLAVNTNGGGLSCVHPGMYGIFALIEAVRQLRGEAGVRQLQRHRTAVVHGNGGTLSSQSTAVLGTADTL 402
222109368 332 GGRLAVNTNGGGLSCVHPGMYGIFALIEAVRQLRGEAGARQLSRHDTAVVHGNGGTLSSQSTAVLGTADTL 402
239820446 322 GGRLPVNTNGGGLSCVHPGMYGIFALIETVRQLRGECGERQVKNAQTALAHGNGGMLSSQATAILGTAEAL 392
160895626 333 GGRLAVNTNGGGLSCVHPGMYGIFALIEAVRQLRGEAGQRQLGRHRTAVVHGNGGTLSSQSTAVLGTAETL 403
116694542 320 GGRLPVNTNGGGLSCVHPGMYGMFITIEAVRQLRGECGERQVRDAEVAVVHGNGGTLSSQATAILGTGATV 390
94314030  322 GGDFPMNTNGGGLSCTHPGMYSIFLVIEAVSQLRGEAGERQVSKVETALVHGNGGVLSSQATAILASSQ-- 390
73537347  320 GGRLPVNTNGGGLSCVHPGMYGMFITIEAVRQLRGECGDRQVKDAEVAVVHGNGGTLSSQATAILGTAATL 390
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap