Conserved Protein Domain Family
PRK06157

?
PRK06157: PRK06157 
acetyl-CoA acetyltransferase; Validated
Statistics
?
PSSM-Id: 180433
View PSSM: PRK06157
Aligned: 21 rows
Threshold Bit Score: 624.745
Threshold Setting Gi: 11497655
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
218781746   1 MADGIRDKVAILGMGCTKFGERWDCSGEDLMVESFLECLAD-AGIEKKEIQAAYFGVHIDEVNVGKAGTPLGAALKLPFI 79 
33593115    1 MATGIKDRVAILAMGCSRFGERWDVGQEELMVEAYAEALAS-AGIEPRAIEAAWYSSHYDDIGAGKAGTPMAMALRLPDI 79 
158521562   1 MATGIRDKVAIIGMGCTKFGERWDANGEDLLVEAFEECLAD-SGLEKKDIEAAWFGTCLEEINVGKTGMPLSTTLRLPMI 79 
118463226   2 PSNGIAGKVAVVAMGCSHFGERWDASTEDLILEAYQECLDSvPNLGADDVDAFWLGT----LSSGLGGLTLSRAIGNDDK 77 
269126932   2 TTRRLAHDVAIVAMGCTPFGDHWGASADDLLVDAVTECMASlPGMSVHDIDAFWVGT----QGSGLSGQVLARPLRLTDK 77 
148554771   1 MAEGIRDKVVILGMGCSRFGERWDCSAEDLISESFREAIAD-AGIDRDQIEAAWFGLSMDEQNLGKSALSLSQTLRLPNI 79 
297617415   1 MAAGIKDKAAVIGMGCTKFGERFDCNLEDLMLEAIEEALAD-SGLEFNDIDAFWFGT----FTSGMAGLAFSNRMKSQYK 75 
284043517   2 ASHSIGDRIAIVGMGCTPFGDHADRGVEDLLVEASSEALAS-AGMDIGDVDAFWLGT----FGSNVAGVTLSKPLKLQYK 76 
218781030   1 MATGIKDKVAIIGMGCTRFGERWDVGAEELMVEAFQECIQD-AGIEKKEIQAAWFGTCLDEVNVGKSAVPLSTTLRLPFI 79 
256394488   2 ASHGIKDRVAIVAMGCTRFTEHWDSGADELLLSATAEAFAG-AGLAKEEIDAYWLGT----AQSGMSGITLARPLELEGK 76 
218781746  80 PITRTENFCATATEAFRAATYAVASGAYDIVLALGVEKLKDTGYGGLPGg-AAFGTEMFMRGSNATAPGLFAQLATAYAA 158
33593115   80 GVTRVENFCAGGTEAFRGAVYAVASGAADIALALGVEKLKDTGFAGLPL--ASRGTLAPMYLLTHSNPGNFAQLARAYQA 157
158521562  80 PVTRVENYCATGTEAFRGACYAVASGAYDICLAQGLEKLKDTGYGGLPNpgSGAGTLTWQWWPNISAPGCFAQLASAYAA 159
118463226  78 PVTRVENFCATGSEAFRNACYAVAAGAYDVAMALGVEKLKDSGYSGLLR--QDPPGDGTAPELSMTAPAAFSMLDPAYCA 155
269126932  78 PVTRVENYCATGSEAFRNAVFGVASGAYDIVMAAGVEKLKDSSQSGLSA----VLPPADGTDVDWTAPAGFSLLVPAYQQ 153
148554771  80 AATRVENLCATGSEALRGAVYAVAAGAVDIALALGVEKLKDTGYGGLPE--RSKGTFNDLWQPGATAPGSFAQFASAYTA 157
297617415  76 PVTRIENMCCTGLDAFRNACYAVVSGAYDVVMAIGAEKLKDGGYSGLEV----PAEDSDRTMPDLTAPARFAVIAPAYAH 151
284043517  77 PVSRNENFCATGSDAFRNACYAVAAGAYDVAMAIGVEKVSDSLGAGIPF----APPQDSGTRLEVTPPGSYSYLSTGYIA 152
218781030  80 PCTRVENYCATGTEAFRGAVYAVASGAYDICLALGVEKLKDTGYGGLPGggSNAGSLMWQWWPMLTAPGSFAQLASAYAA 159
256394488  77 PVTRVENYCATGSEALRQAAYAVASGAYDVAMAVGVEKVKDSGYQGLNA----FPIPGDGTARTVTAAAMFSMVVPAYGA 152
218781746 159 KYNIPMEKIKDAIAHVSAKSHFNGAMNPKAHLRKAVPEEAIKAAPMIAYPLGLFDCCGVSDGSAAAIVTTPEIAKSLKPN 238
33593115  158 RHGVAREDLKAAMAHTSMKSHANALHNPKAHLRKAISREQAAGAPLVADPIGLFDCCPVSDGAACAIVTTPEIARSLNRG 237
158521562 160 KYKVSDRDLKRAIAHVSVKSHANGALNPKAHLQKAVTEEQVMNSPIIAHPLGLFDCCGVSDGSACAIVTTPEIAKKMGRK 239
118463226 156 RHGVHPDEMRAAMTHVAWKNHDNGTRNPKAQFRSPVSRDTIDNAPKVAGRLGVFDCSGISDGAACALIVPAERAREYTD- 234
269126932 154 AYGVSDADMRRALTHVAVKNHANGALNERAQFRRPVTPEAVEKSPRIAGALGVMDCSGVSDGAAAAVIVRAEDAHKYTD- 232
148554771 158 RHGVDMATLKEAMAHISWKSHENGSKNPKAHLRQRLSKEAIVKAPMVAYPLGLFDCCGVSDGSACAIVASPEMAMRLGRT 237
297617415 152 KYGLSMQQMKEVMARIAWKNHKNGSLNPKAQFQAEVPIENILKSPMICSPLGIMDCSGVSDGAACAIIVRSEDAKKYRP- 230
284043517 153 KYGVSPEDLKAALTHVAWKNHANGARNARAQYRKALTKERIASAPDLAGNLSLLDCGGLTDGAAAVIICRAEEAHRYAK- 231
218781030 160 KYKIPDGDLKRAMAHVSAKSHDNGVLNPKAHLQKKVTEDQIMAAPIIASPLGLFDCCGVSDGSACAIVTTPEIAKKMGKK 239
256394488 153 KYGVAPQEMREVLARIAAKNHANGARNPKAQFRKEWPVEQLLAMPRVAGELSVFDCAGVADGAAAAIVVRAEDALRYTD- 231
218781746 239 q-DIIKVKALQISVSSGEEETYTNWDGAHFATTRVAATKAYEEAGIKNPREEVSMMEVHDCFSITEFVTMEDVHISPKGG 317
33593115  238 --PLVLVKAIQLATSNGWELQQSDWDGSYVHTTRVAARKAYAEAGIDDPRAQLSLTELHDCFSITELVTLEDIGLAEPGT 315
158521562 240 kaEIISVKALQVALSSGQEVGYNEWDGEHFMTTSVCSTRAYKEAGIQDPRKEISMMEVHDCFSITELVTYEDLHISERGQ 319
118463226 235 --TPMYVEALSLIAGSARASMDPGYDFTTFPEVVKSAKDAYTQAGIEHPARELSLAEVHDCFTPTEIVLMEDLGFSVAGN 312
269126932 233 --RPVYLKGMSFVAGSGSGLAATGYDFTTFPEVVTAARRAYEQAGVTDPAREISLAEVHDCFTPTEIVLMEDLGFSERGK 310
148554771 238 g-ELVSVKSMQLALSNGSEMSHDAWDGSYAHTTRIASRKAYREAGIVDPVKELDLVEVHDCFSITELVTMEDLGLSQPGM 316
297617415 231 --DPMYVKGIQIAAGPGHSEKHQSYDFTTAWETYYAGQAAYREAGITNPREQIDLAEVHDCFTPTELIIYEDLQFSARGQ 308
284043517 232 --DAVYVKALSLAVGPGTGAMDSDYDYTSFPEVAASAQEAYRQAGVTDPRAQIGMAEVHDCFTVTEVVLMEDLQFAPRGT 309
218781030 240 --DFITVKALQLALSSGEEVGYNDWDGDHFMTTSRASVKAYEEAGITNPREEISMMEVHDCFSITELVTMEDLHISERGQ 317
256394488 232 --KPLYIKALSLVAGNGLPLGDPGYDYTTFPEIVAAAEDAYRQAGVADPRRELAMAEVHDCFTPTELVLMEDLGFCERGK 309
218781746 318 AYEDVMNGFYDlKGGGVPCQVDGGLKCFGHPIGASGLRMIYAMYEQLLERVpEERAVKN---ARFGLTHNLGGTPAKNVA 394
33593115  316 AWRGMLDGRFD-ADGALPCQIDGGRKCFGHPVGASGLRMLYEAWLQLSGRA-GARQLPA---PSLALTHNLGGAPAQNVC 390
158521562 320 AWKDSLNGVYD-RDGEVPCQIDGGLKCFGHPIGASGLRMLYEMYLQLLGRA-DKRQLDN---PKIGLTHNLGGFPFQNIC 394
118463226 313 AWKDVLSGEFD-ADGRLPVNPDGGLKSFGHPVGASGLRMLYEAWLQFGGRA-GARQLSD---PHTALTHNLGGRPGGCVS 387
269126932 311 AWRDVLDGRYD-LRGALPVNTDGGLKSFGHPIGATGLRMMFECFTQLRGEA-GERQVEG---ARLAVAQNLGGQPGSTVA 385
148554771 317 GYRDVLAGKFD-ADGEVASNIDGGLKCFGHPIGASGLRMVYEGYTQLLNRA-GDRQLSR---PRRALTHNLGGFPNYNVC 391
297617415 309 GWRDALDGFFD-LDGKLPVNPDGGLKSFGHPIGASGIRMLYESWLQFHGKA-GKRQLEN---PKIGLAHNLGGQPYQCVV 383
284043517 310 AWREILDGAFD-IDGVLPVNPDGGLKSFGHPLGASGIRMLFESWLQLRGQA-GERQIDLg--GKLAMTQNLGGWPGDCLS 385
218781030 318 AVKDIMDGFYDlKGGGVPCQVDGGLKCFGHPIGASGLRMLYEMYLQLHGKA-GERQIEN---PRLGLTHNLGGFPFQNVC 393
256394488 310 AWQEVLAGAFD-LDGDLPVNPDGGLKSFGHPVGASGLRMMYEAWLQLRGEApEQRRISTfgqRELALTHNLGGYPGEMVG 388
218781746 395 AISIIGRD 402
33593115  391 SITILGAA 398
158521562 395 AISIIGKY 402
118463226 388 FVSIVSRT 395
269126932 386 FVAVLGSE 393
148554771 392 SISILGLL 399
297617415 384 GVAVVGKE 391
284043517 386 FVSLLSAQ 393
218781030 394 AISIVGKY 401
256394488 389 FVSILGTR 396
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap