Conserved Protein Domain Family
PRK06147

?
PRK06147: PRK06147 
3-oxoacyl-(acyl carrier protein) synthase; Validated
Statistics
?
PSSM-Id: 235715
View PSSM: PRK06147
Aligned: 17 rows
Threshold Bit Score: 340.074
Threshold Setting Gi: 221369471
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
77465470   10 GLSVVGYGMWTALGPDGPTTVAGL---DARLIVS-QSGDLREPltGAALPCFRLA------AQHWWAGPSFLSEMLLPVL 79 
119385165   1 MIGVLAAGMVTAVGLDWVASAAAM---RARLDGF-AETRFIAP--GGWRIGAPVP------LPRNWIGQRRMAHLAAGAV 68 
218888843   4 VLSIVASGMVSAVGLSAPASCAAI---RCALDNF-QETRFIDQg-GEWLVGAPVM------LPEPSSGYAQLVGMAAMAI 72 
190895280   5 ALDVLACGMVTAVGLDAPSACAAI---RARVDGF-QETRFQSGp-DEPIIGAPIP------LIPEVVGEQRMAYMVAAAI 73 
126463872  10 GLSVVGYGMWTALGPDGPTTVAGL---DARLIVS-QSGDLREPltGAALPCFRLA------AQHWWAGPSFLSEMLLPVL 79 
221369471  10 GLSVVGYGMWTALGPDGPTTVAGL---DARLIVS-QSGDLREPltGAALPCFRLA------AQHWWAGPSFLSEMLLPVL 79 
302037318   3 HLAIKASGMVTSLGFNSPASCAAI---RAGIRNV-NKTNLWDAesGEYLAAGRVL------LPHWWVGLGKLAELVAPAI 72 
78221510   16 RVVITGIGTVTSLGCSQWSTALALrfrKSSWCEH-ETVLVADDpyGAVLRGATISripeeiISPELDGAERAEALFHPAL 94 
39998271    3 TLAITGASCVTAVGHDGPSTAASV---RAGISRFaEYDDYRDEndNPITAARICG------IHDSWDTPQRMAGVAALCL 73 
239813558   5 AIAILRSGLVTPVGLDAESSCAAF---RAKLTNP-VETRFIDAg-GEWIMAHEVP------LTPLCRGLPKLTRMAAMAI 73 
77465470   80 GECAEQLAalpaplrrPASEVPVLIAVAPCGRPARPDDLEARLLAEL--EARLGp--LPEGSAVVGAGRVGLPHLIARAA 155
119385165  69 ADILRQEP--------AATEAALILCLAEEGRPGRPVQDPSALLRML--SQILGl--PERRAHVVAHGRPSGFVGLERAR 136
218888843  73 AECVAGLPa------eDIREMPLLLGVAEVDRPGRLAGLEQPLLQAI--EERLGy-rFHERSCVIPRGRVSAAVALLNAR 143
190895280  74 RESLDPLSt------pRAMAAQLVLCLPEEGRSGSPIEDSVRLVRQI--GDLLGn-sATGPTRVISEGRPAGHAALRTAA 144
126463872  80 GECAEQLAalpaplrrPASEVPVLIAVAPRGRPARPDDLEARLLAEL--EARLGp--LPEGSAVVGAGRVGLPHLIARAA 155
221369471  80 GECAEQLAalpaplrrPASEVPVLIAVAPRGRPARPDDLEARLLAEL--GARLGp--LPEGSAVVGAGRVGLPHLIARAA 155
302037318  73 HECLEAARp------vQATSIPILLGLSSPQRPCRFPDLTETILNEV--QDRLGf-rLNSASHVIARDHVSVVIGLKKAQ 143
78221510   95 KECMAGL---------SIAEQKRLVC-----RIDNFIDYEQHLFPSLlqEAFPGl-sLEHGQKPIELGRCSLFERIIQAG 159
39998271   74 EKLLDEYFrrd---arRPSQIHLFLGVASDERPG--PRYEESSLFPL--RGIIGkwtDKPGLQAIRRGNASMMCSLEQAG 146
239813558  74 EEALGEVPr------sQWGQLPLILCVAEPMRPGRTPGLDDELFLQI--QEELGt-aFAPQSQIVAQGRVGVAVAFAQAR 144
77465470  156 RQ--AGRHPVQILIGVESFLLQEIVDHYADRHRLLSEE--NSSGFVPGEAAAALIVAPRgma--pgLALKG----LGAGR 225
119385165 137 RMiaAGQAGRVILLGLDSYLTGPALAHYAGLERLLQNG--NADGFIPGEAAAAVLLGPGg-----aLRLTG----LGLAR 205
218888843 144 KLi-EQGCSKVLIAGVDSYLTAATLAAYQERDRLLGSH--CQDGFIPGEGAAAVLVTAAcaseepqLLCLG----LGFGV 216
190895280 145 RLlaDADTDHVVIAGVDSYLTAGTVTHYLAENRLLTPD--NANGFIPGEAAGAILCGRAgq---gnFRLAG----LGLSR 215
126463872 156 RQ--AGRHPVQILIGVESFLMQEIVDHYADRHRLLSEE--NSSGFVPGEAAAALIVAPRgma--pgLALKG----LGAGR 225
221369471 156 RQ--AGRHPVQILIGVESFLLQEIVDHYADRHRLLSEE--NSSGFVPGEAAAALIVAPRgma--pgLALKG----LGAGR 225
302037318 144 ELieSGQTKYCIVAAVDSLIQQDLGEYYLNQRRLLTPM--NSNGFCVGEAGSAILVGASggtikseLEVLG----IGMAR 217
78221510  160 GEllAGNAERILVGCVDSLCATSWLMSVCDEDVLKDSL--TPEGIIAGEAAGAVLLEREaaarrrnAPVLAilssWGRGT 237
39998271  147 RLidSNPDAVCIVGGVDSLLRTSTLNWFEKDCRLKSASygRHQGLIAGEAVGFMVIGEHagakqadRPILGsiagLGLAV 226
239813558 145 ALliESGMPQVLVAATDSLLSWSTLSHYEQSDRLLTAR--NSNGFMPGEAAGAMLLGEPegn-ageLLCTG----VGFGL 217
77465470  226 EPSGAGGSRD-----APVTGEGLTDAIRAALAAAEIPLFDIPIFLGDLNGEHFKFKEAMIATMRLDRlppenvsrRPRGH 300
119385165 206 EAAFLGNARGedgadLPLRGDGMAAAYRAALAEAETDLAHVEYRISDLPGEQHFFRQAALMTLRLER--------GRTAF 277
218888843 217 EKATV-ESEG-----LPLRADGLTQAVKAAFADCGFGYELVDYRLADLPGDQYYFKEAALALSRTLR--------VRKER 282
190895280 216 EQAFIYNGLDadgmhVPLRGDGMTAAYREALAECRIEMAGLGYRIADLIGEQYWFRQSALASIRLVR--------GAHDF 287
126463872 226 EPSGAGGSRD-----APVTGEGLTDAIRAALAAAEIPLFDIPIFLGDLNGEHFKFKEAMIATMRLDRlppenvsrRPRGH 300
221369471 226 EPSGAGGSRD-----APVTGEGLTDAIRAALAAAEIPLFDIPIFLGDLNGEHFKFKEAMIATMRLDRlppenvsrRPRGH 300
302037318 218 ESSPI-ESEE------PIRGDGLAQAIGEAFRESGLTIQDLHYRITDLNGEHYKFKEMAFAMMRYERk-------PKPKL 283
78221510  238 EPNLWHGP-------IPSTGRGLTDAFLEAISPHGDGGKGVVTVIADLNGDRHRALDWAYTEGRIFI--------DGDRE 302
39998271  227 EPAP--RASS-----ALGRNSGLTEACHAALS--GVQKKAIRAIFSDLNGENSRAREWGMAEMRCFD--------KPDES 289
239813558 218 EEAHVESE-------VPLRAEGLSQAVKAALADAGCQMHQMDFRITDLSGEQYYFKEAALALSRTLH--------VRKKE 282
77465470  301 PEHWNAIEGLGEIGAALMPAQLGWAFEASRSGRLPQGRALAFAGEDDGARVAIVAAAAGGPVR 363
119385165 278 QDLWSPAESLGNIGAAAVPAMLGMALAAVRKGYAPGSPVLVEASGDDGACGAAVLHEARGPAR 340
218888843 283 VELWSPADCIGECGAMTGPALLCIALAASRKGYAHGPQVLCHSGNDAGERAAVVLGYQRVRAN 345
190895280 288 QDIRSPAESLGNVGAAVVPIMVGMAMTAAAKGYSGGSPVLIEASNDSGACGAAIFASRVQ--- 347
126463872 301 PEHWNAIEGLGEIGAALMPAQLGWAFEAARSGRLPQGRALAFAGEDDGARVAIVAAAAGGPVR 363
221369471 301 PEHWNAIEGVGEIGAALMPAQLGWAFEAARSGRLPQGRALAFAGEDDGARVAIVAAAAGGPVR 363
302037318 284 FDLWHPIEFIGDVGAAIGPILLAVALHASQKQYGVGPRVLCTLGDDDGERAALVLNYRAGNS- 345
78221510  303 PELRHPAFIAGDCGKATGALLLADALGRFAFHPGFRGTLALSTSDESGARRVICLEHGDHEER 365
39998271  290 RRLWTPANCYGDIGAASGVALASIAMQGLVRGWLQSP-ILVTCSDDHGPCGALVLESEK---- 347
239813558 283 FDIWHPAECTGEIGAAVGLAIVSAAQAACEKQYAKGPNILAHLANDAGQRAALCLQYRMPV-- 343
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap