Conserved Protein Domain Family
PRK06066

?
PRK06066: PRK06066 
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 180380
View PSSM: PRK06066
Aligned: 16 rows
Threshold Bit Score: 630.631
Threshold Setting Gi: 18313381
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
302349059   1 MGNGRVAVIGVGFYGFRPSTPEVSFQGMMFESSHRAYAEAD-VDPRKDIDVFVDCQEDMWEGIAITDEFAPEPIGGALRP 79 
11498573    5 IGDGMVAVVGVGYAGFNSTTPDLSWKEIMYEAAVRAYTDAG-INPRRDVDSFVTCAEDIYEGFAIFDEFVPDQLGAVVKP 83 
18313381    1 ---MRVGIAGIGWFGFQPEVVDYSFREMMFKAAQRAYEDAGgLDPRRDVDAFVSCQEDFWEGIAISDEFAPDPIGGAMKS 77 
284997062   3 TFLNRIAIIGIGWFGFRSTTPEVSFREMVFEAASRAYKDAGnINPRNDVDSFISCQEDFWEGISIADEFAPDQMGGAMRP 82 
227827021   3 TFLNRIAIIGIGWFGFRSTTPEVSFREMVFEAASRAYKDAGnINPRNDVDSFISCQEDFWEGISIADEFAPDQMGGAMRP 82 
229584190   3 TFLNRIAIIGIGWFGFRSTTPEVSFREMVFEAASRAYKDAGnINPRNDVDSFISCQEDFWEGISIADEFAPDQMGGAMRP 82 
227829856   3 TFLNRIAIIGIGWFGFRSTTPEVSFREMVFEAASRAYKDAGnINPRNDVDSFISCQEDFWEGISIADEFAPDQMGGAMRP 82 
229578812   3 TFLNRIAIIGIGWFGFRSTTPEVSFREMVFEAASRAYKDAGnINPRNDVDSFISCQEDFWEGISIADEFAPDQMGGAMRP 82 
15922114    1 ---MKVAIVGIGWYGFRPNTKDVSFREMMFEAAVRAYEDSGnINPRTDVDTFISCQEDFWEGIAITDEFAPDPIGGAMRP 77 
146303056   1 --MENVGIVGIGWYGFSTNVHDLSFREMMFEAAQRAFYDAGgMNPREQVDAFISCQEDFWEGISISDEFAPDPVGGAMRP 78 
302349059  80 TFTVSGDGLLGVAHAYMLIRSGLANVVAVESHGKPSEIKTLQDIYYFAMDPLHIRPLSTGNPFFIAGLDAQAYMSRTGAR 159
11498573   84 TCTVTADFLYGVATAYMHINSGLADIAVVEAHSKASDIQTFGNVVKFAMDPIWLRNVGNAHPYYLAALEMFQYMAERCLS 163
18313381   78 VYTVTGDGLQCVGQAYMMIKSGLFDVVVVESHAKPSDIMTLNDVMAMATDPIYVRPLGLDNVHALAALEARAYMSKYGVT 157
284997062  83 TMTVAGDALQGLAHAVMHINSGVANVVSIEAHSKVSDILTFSDLVKFAMDPIYVRSINPPNFHFIAGLDAVKFMQRKGIT 162
227827021  83 TMTVAGDALQGLAHAVMHINSGVANVVSIEAHSKVSDILTFSDLVKFAMDPIYVRSINPPNFHFIAGLDAVKFMQRKGIT 162
229584190  83 TMTVAGDALQGLAHAVMHINSGVANVVSIEAHSKVSDILTFSDLVKFAMDPIYVRSINPPNFHFIAGLDAVKFMQRKGIT 162
227829856  83 TMTVAGDALQGLAHAVMHINSGVANVVSIEAHSKVSDILTFSDLVKFAMDPIYVRSINPPNFHFIAGLDAVKFMQRKGIT 162
229578812  83 TMTVAGDALQGLAHAVMHINSGVANVVSIEAHSKVSDILTFSDLVKFAMDPIYVRSINPPNFHFIAGLDAVKFMQRKGIT 162
15922114   78 TMTVTGDGLQGILHGVMHIKSGLANITVVESHAKPSDILTIRDIIEFAFDPMY--RIGAKNIHFLAGLEALKFMKLRNAT 155
146303056  79 TMTVAGDGLQGLAHGFMLINSGVADVVVVESHAKPSDILTFPEIVELAMDPVYVREAKIPNYHFIAGLDATKFMHRTGVS 158
302349059 160 REHLAMVAVKNRNNGLRNDRAPYSSRISLDEVLSSPYAVYPMTRYEMAGFSDASVTVVLASEDVAKKFT-DKVVWLDGVG 238
11498573  164 EEDVARVVVKNKNNALLNPAAPYAANVTLDDVMASPKLFDPMKKMEIAPLADGCVVFVLASDEVARKLT-DNPVWVKGIG 242
18313381  158 EEHLDAVVEKAHKAGVKNPRAAYASPGRERSA--TPIVADPLREADIAKFVDAAVVVVLASERAVREYT-DTPVWIDGAW 234
284997062 163 REDLALVVEKNKKAGLSSPRASYASNISAEDVLKKDYVVYPLSELDMAPFVDGAIVIVVADEEVGKKLKkDDYLVIKGLG 242
227827021 163 REDLALVVEKNKKAGLSSPRASYASNISAEDVLKKDYVVYPLSELDMAPFVDGAIVIVVADEEVGKKLKkDDYLVIKGLG 242
229584190 163 REDLALVVEKNKKAGLSSPRASYASNISAEDVLKKDYVVYPLSELDMAPFVDGAIVIVVADEEVGKKLKkDDYLVIKGLG 242
227829856 163 REDLALVVEKNKKAGLSSPRASYASNISAEDVLKKDYVVYPLSELDMAPFVDGAIVIVVADEEVGKKLKkDDYLVIKGLG 242
229578812 163 REDLALVVEKNKKAGLSSPRASYASNISAEDVLKKDYVVYPLSELDMAPFVDGAIVIVVADEEVGKKLKkDDYLVIKGLG 242
15922114  156 REDFAKVIVKNKRNGLKNPRASYASNISLEDILEREYTIYPLTDLDISRFVDAAIVVVLASEEIARKYT-DTPIWIDGIY 234
146303056 159 REDLAEVVIKNRASGLKTGRAPHASLLSKEDVLSQEAVVYPLTRVDIARPVDGAVVVVLASETFARKFN-DTPIWITGIG 237
302349059 239 YSTEvgSGSIEWHQWgRMPSMRNAALMAYKLAGLSDPQKDVSFAEVEDRFSFMELLSAEELMLSPEGEAHKMLEAGEFDF 318
11498573  243 WWSE--TYGYDTASF-SAMYAYKAAKMAYKMAGIANPAKEVDFAEVDDRFAFKEMQHIEALQLAGKFDVARLMAEGYFDR 319
18313381  235 WSTE--ISSLELHDWsFPIHAREAADGAYQQAKIADPAKEVGFAEVDNRYSFKELQHIEALRLAPKGLAKDLLADGAFCP 312
284997062 243 FVTD--SSNLETAELgKANYMRIASDMAYRMAGIESPRRYFDAVFVDDRYSYKELQHLEGLRVSEEPSKD--LREGNLSP 318
227827021 243 FVTD--SSNLETAELgKANYMRIASDMAYRMAGIESPRRYFDAVFVDDRYSYKELQHLEGLRVSEEPSKD--LREGNLSP 318
229584190 243 FVTD--SSNLETAELgKANYMRIASDMAYRMAGIESPRRYFDAVFVDDRYSYKELQHLEGLRVSEEPSKD--LREGNLSP 318
227829856 243 FVTD--SSNLETAELgKANYMRIASDMAYRMAGIESPRRYFDAVFVDDRYSYKELQHLEGLRVSEEPSKD--LREGNLSP 318
229578812 243 FVTD--SSNLETAELgKANYMRIASDMAYRMAGIESPRRYFDAVFVDDRYSYKELQHLEGLRVSEEPSKD--LREGNLSP 318
15922114  235 SATD---STIELSELgEARYMKIASKEAYNMAKVN--KREIKAAFVDDTYSYKELQHIEGLSLSDNAVKD--LREGEFER 307
146303056 238 FATD--NSNLELARLgDALYTRKASSLAFSMARLESPLK-VNGLFVDDRYSYKELQHVEALGVTNVAEK---FREGYFHE 311
302349059 319 DGRLPLNPSGGSLAMGVSLEATGLARFLEAVLQLRGEAGAHQlKEARRAVVASWRGVPTYTSAVAVLSS 387
11498573  320 DGAKPVNVSGGSLGVGNLLECTGGQKALEVVLQLRGEAGKRQlSDVEVGVAQAWRYLPTHSGAVAVFGV 388
18313381  313 GGRLPVNLSGGALAEGVPFEAHGLARLSYAVWVMRGDIKAEV-DRRDVAVVHSWRGVPTTTSTAVVLRI 380
284997062 319 QGEIPVNPLGGHIAKGVPLEASGFSLLLDAIDYIKQ-------GKGERALVASWRGIPTLTGSVVVVEK 380
227827021 319 QGEIPVNPLGGHIAKGVPLEASGFSLLLDAIDYIKQ-------GKGERALVASWRGIPTLTGSVVVVEK 380
229584190 319 QGEIPVNPLGGHIAKGVPLEASGFSLLLDAIDYIKQ-------GKGERALVASWRGIPTLTGSVVVVEK 380
227829856 319 QGEIPVNPLGGHIAKGVPLEASGFSLLLDAIDYIKQ-------GKGERALVASWRGIPTLTGSVVVVEK 380
229578812 319 QGEIPVNPLGGHIAKGVPLEASGFSLLLDAIDYIKQ-------GKGERALVASWRGIPTLTGSVVVVEK 380
15922114  308 GGKIEVNPLGGHLAKGRPLEVSGLSLLLDAVEYLRQ-------GVVDKAVVASWRGIPTFTGVVGVVSR 369
146303056 312 GSYLPVNPKGGHLAKGYPLEASGLSLVLDAVEYMR--------EGASSAIVASWRGIPTFTGGVAVMQR 372
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap