Conserved Protein Domain Family
PRK06065

?
PRK06065: PRK06065 
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 180379
View PSSM: PRK06065
Aligned: 16 rows
Threshold Bit Score: 769.375
Threshold Setting Gi: 288932874
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18313382    2 TSRNINFKHRVAVVGAGLTLFRSRMLETPQELAWLAAKQALDEAGLTLKDIDCVVIGSAPDAFDGVHMKGEYLAEGAGGI 81 
11498572    7 SGLKFHKKQDVAIVGAGMTTFKRRLNETGRELSYLAVKQALEEAGLTIDDIEMVVMGSAPDAFDGFHMKGEYLLDGSGGS 86 
229582441   1 MKVNIHLNKRVAVIGAGLTLFRRRLLETPQEIAWEAASKALDEAGLELKDIDCVVIGSAPDAFDGVNLKGEYLSHGSGGI 80 
284997061   1 MKVNIHLNKRVAVIGAGLTLFRRRLLETPQEIAWEAASKALDEAGLELKDIDCVVIGSAPDAFDGVNLKGEYLSHGSGGI 80 
227829857   1 MKVNIHLNKRVAVIGAGLTLFRRRLLETPQEIAWEAASKALDEAGLELKDIDCVVIGSAPDAFDGVNLKGEYLSHGSGGI 80 
229578813   1 MKVNIHLNKRVAVIGAGLTLFRRRLLETPQEIAWEAASKALDEAGLELKDIDCVVIGSAPDAFDGVNLKGEYLSHGSGGI 80 
70607941    1 MKVNIHLNKRVAVIGAGMTQFRRRILETPQEIAWEASSKALEEAGLELKDIECVVIGSAPDAFDGVNLKGEYLSHGSGGI 80 
15922113    1 MKTNLYFR-RVAVIGAGLTLFRRRMLETPQELAWEAARKALDEAGLELKDIDCVVIGSAPDAFDGVHMKGEYLAHGSGGV 79 
146303055   1 MKTNLKFR-RVAAIGAGMTPFRRRMLETPQEMAWEASRRALDEAGLELRDIDCVVIGSAPDAFDGVHMKGEYLAHGAGGV 79 
14602032    3 SRPNIHVKSKVAVVGAGITLFRRRMLETPRELAWEAARQALDSAGLTLRDIDCVVIGSAPDAFDGVHMKGEYLADGSGGL 82 
18313382   82 HKPVIRVFVGGATGVFVPIAAWWHVASGLCKKVLAVAEEKMShAAKPHTQYVFRYIWDPIVEKPLNPNLIWIFAMEMHRY 161
11498572   87 NRPYMRVFVGGGTGVFAPIAGYWHVASGLADVCLVVCEEKMS-SVHPHPQSAFKYIWDPILDRPLNPNLIWIFALEMRRY 165
229582441  81 RKPVSRVYVGGATGVMTAIAGWYHVASGLCQKVLAVAEEKMS-PDRPHPQAIFRYIWDPILEKPLNPNLIWIFAMEMHRY 159
284997061  81 RKPVSRVYVGGATGVMTAIAGWYHVASGLCQKVLAVAEEKMS-PDRPHPQAIFRYIWDPILEKPLNPNLIWIFAMEMHRY 159
227829857  81 RKPVSRVYVGGATGVMTAIAGWYHVASGLCQKVLAVAEEKMS-PDRPHPQAIFRYIWDPILEKPLNPNLIWIFAMEMHRY 159
229578813  81 RKPVSRVYVGGATGVMTAIAGWYHVASGLCQKVLAVAEEKMS-PDRPHPQAIFRYIWDPILEKPLNPNLIWIFAMEMHRY 159
70607941   81 RKPSSRVFVGGATGVMAAITGWYHVASGMCNTVLVVAEEKMS-PARPHPQSVFRYIWDPILEKPLNPNLIWIFAMEMHRY 159
15922113   80 RKMVSRVFVGGATGVMVPNTAWYHVASGLCEKVLAIAEEKMS-PARPHPQSVFRYIWDPITEKPLNPNLIWIFAMEMHRY 158
146303055  80 MRPSSRVYVGGATGVMTAIAGWYHVASGMCKKVLAVAEEKMS-TGRPHPQAVFRYIWDPITEKPLNPNLIWIFAMEMHRY 158
14602032   83 FKPTVRVYVGGGTGVFVPIAAWWHVASGLCRTVLAVAEEKMS-HARPHPQGVFAYIWDPVLERPLGPNLLWIFALEMRRY 161
18313382  162 MYKCGVKKEDIALVSVKNKRNACGHPSAQLCmPNITVDDVLKSEVLVWPVQLLDISPTSDGAAAVVLASEEEARRITDTP 241
11498572  166 MHVHNIKHEDIALVSVKNKANALDHPCAQVA-EKITVEDVLNSEPMALPVRRLDVSPPSDGAAALIMVAPHIARQLTDNP 244
229582441 160 MATYGIKKEEIALVSVKNKRNAVNNPYAQLG-SKITVEDVLKSEVLVWPVQLLDVSPVSDGGAAIVLASEDLARRYTDTP 238
284997061 160 MATYGIKKEEIALVSVKNKRNAVNNPYAQLG-SKITVEDVLKSEVLVWPVQLLDVSPVSDGGAAIVLASEDLARRYTDTP 238
227829857 160 MATYGIKKEEIALVSVKNKRNAVNNPYAQLG-SKITVEDVLKSEVLVWPVQLLDVSPVSDGGAAIVLASEDLARRYTDTP 238
229578813 160 MATYGIKKEEIALVSVKNKRNAVNNPYAQLG-SKITVEDVLKSEVLVWPVQLLDVSPVSDGGAAIVLASEDLARRYTDTP 238
70607941  160 MATYGIKKEEIALVSVKNKRNAANNPYAQLG-GNITVDDVLNSEVLVWPVQLLDISPVSDGGAAMVMASEDVARRYSDTP 238
15922113  159 MHVNKVTKEDIALVSVKNKKNALNNPYAQAA-ANITVNDVLKSEVLVWPVQLLDTSPVSDGAAAMVIVNEDVARRYTDTP 237
146303055 159 MFVNKVSKEEIALVSVKNKRNAASNPYAQLG-GEITVDDVLRSEVLVWPVQLLDVSPVSDGAAAMVFVDGDIARRYTDTP 237
14602032  162 MHKCNVSKETIALVSVKNKRNALDHPAAQAA-ANITVEDVLNSEVLVWPVNRLDVSPVSDGAAALVLASENEARRVTDSP 240
18313382  242 VWIKGIGWTLDTTHWTNRDLAYPEYVRRAAEMAYRMAGIDNPRKQIDVAEPYDPFDYKELHHMEGLGLARKCEAPILTRE 321
11498572  245 VWVTGVGWALDTTWWTNRDLYFPRYVAEAAKMAYRMAHITDPRKEIDVAEPYDPFDYKELHHMEGLGLAKKGEAPILTRE 324
229582441 239 VWVEGVGWTLDNTEWPARDLSYARYVEFAARMAYKMAGIERPTKEIDVAEPYDPFDYKELHHLEALQLAKRGEAPKLLKE 318
284997061 239 VWVEGVGWTLDNTEWPARDLSYARYVEFAARMAYKMAGIERPTKEIDVAEPYDPFDYKELHHLEALQLAKRGEAPKLLKE 318
227829857 239 VWVEGVGWTLDNTEWPARDLSYARYVEFAARMAYKMAGIERPTKEIDVAEPYDPFDYKELHHLEALQLAKRGEAPKLLKE 318
229578813 239 VWVEGVGWTLDNTEWPARDLSYARYVEFAARMAYKMAGIERPTKEIDVAEPYDPFDYKELHHLEALQLAKRGEAPKLLKE 318
70607941  239 IWVDGVGWTLDNTEWPARDLAYPRYLEFAARMAYKMAGIENPYKELDVIEPYDPFDYKELHHIEGLRIAKRGEAPKLLKE 318
15922113  238 VWIEGVGWTLDNTEWTGRELAYPRYLEHAARMAYKMAGIERPNKEIDVIEPYDPFDYKELHHIEGLMIARRGEAPKLLKE 317
146303055 238 IWVEGVGWTLDNTSWPNRELAYPRYLENAARMAYRMAGIERPQKEIDVVEPYDPFDYKELHHLEGLMLAKRGEAPLLLKE 317
14602032  241 VWIEGVGWTLDNTHWYNRELGYPRYVQYAARMAYKMAGIERPWRDIDFAEPYDPFDYKELHHIEGLMLARPCEAPKLLEE 320
18313382  322 GVTQRDGDLPINPSGGLLGVGNPIAAAGLMKVAEIFWQVRGEAGARQVKKPVYTGLAQAWGDLMQAGTVIVMGI 395
11498572  325 GVTQRDGDLPTCPSGGLLGVGNPIAATMGVKACEIYWQLAYRAGKRQVAKEVTTGVCQAWGDLMQVGTVMVMSN 398
229582441 319 GVFDIDGDIPSSPSGGLLGVGNPIAAAGLMKVISIYWQLKGTAGKMQVKRPVHTGVAQAWGDLMQAGTVIVLRN 392
284997061 319 GVFDIDGDIPSSPSGGLLGVGNPIAAAGLMKVISIYWQLKGTAGKMQVKRPVHTGVAQAWGDLMQAGTVIVLRN 392
227829857 319 GVFDIDGDIPSSPSGGLLGVGNPIAAAGLMKVISIYWQLKGTAGKMQVKRPVHTGVAQAWGDLMQAGTVIVLRN 392
229578813 319 GVFDIDGDIPSSPSGGLLGVGNPIAAAGLMKVISIYWQLKGTAGKMQVKRPVHTGVAQAWGDLMQAGTVIVLRN 392
70607941  319 GVFDIDGDIPSSPSGGLLGVGNPIAAAGLMKVISIYWQLKGTAGKMQVKKPVHTGLAQAWGDLMQASTVIIMRN 392
15922113  318 GMFDIDGDIPSSPSGGLLGVGNPIAAAGLMKTISIYWQLKGTAGRMQVKKPVHTGVAQAWGDLMQASTVIVMRN 391
146303055 318 GFFDKDGDIPSSPSGGLLGVGNPIAAAGLMKVISIYWQLKGTAGKMQVKRPVHTGVAQAWGDLMQASTVMVMRN 391
14602032  321 GWFDRSGELPTSPSGGLLGVGNPIAAAGLMKAAELFWQLRYEAGARQVKKPVHRGVAQAWGDLMQAGTVVVMGN 394
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap