Conserved Protein Domain Family
PRK06064

?
PRK06064: PRK06064 
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 235688
View PSSM: PRK06064
Aligned: 76 rows
Threshold Bit Score: 559.899
Threshold Setting Gi: 119719675
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11497899    3 SENVAVIGVGHSKFGTRKDVNIAELCWESMKPAFESANLEPKDIEFFVVSNA--GMWSSEAAVPALMAEYADLA--PKGS 78 
284161267   1 MRGVAVIGVGCSKFGELWEMGFRDIVISAGVEALEDAGLEGREIEAVYAGNMsaGRYIGQEHIASLIADYSGLAdlHVPC 80 
11499992    1 MRRVAVVGVGQSKFGELWEKGFRDIVLEAGREALEDADLEGREIEAMFVGNMsgGRYLGQEHVAALIADYAGLAefGIPA 80 
242398786   4 MRKPVIIGVGLTPVGEHWRLGLRDLAVEALLNAMEDAGID--KVDSLYVGNMasGSFVEQENLGALIADWAGLG--NIPA 79 
240102517   4 MRKAVIIGAGMTPVGEHWKLALRDLAVEALLNAMEDAGVD--KVDSLYVGNMasGSFVEQENLGALIADWAGLG--NIPA 79 
212224452   1 MEKAVIIGAGMTPVGEHWKLALRDLAVEAILKAMEDAGID--SVDSLYVANMisGPLVEQENLGALIADWAGLG--NIPA 76 
119719675   1 MTGVYLVGIGATKIDEHWERPLRDLMLEASLKALRDAGLSKRDVEAIFVGNMssGYLQGQEHLGSLLATWLGVP--GVAA 78 
16082423    3 LSDVYIIGAGETKFGELWDKSLRDLAVEAGLEAIKDANIYSRDLQMLYASNSlaGTINEQSNIAALAADFSGIAetHVPA 82 
13540962    4 SNDVYIIGAGETKFGELWDKSLRDLAVEAGLEAIKDANIYSKDLQMLYASNSlaGTINEQSNIAALAADFSGIAenHVPA 83 
48477455   17 LSDVYIIGAGETKFGELWDKSLRNLAVEAGLKAIENAGIYSKDIDIIYGANGlaGVINKQENIGALIADFSGLSeeGIPA 96 
11497899   79 MRVEAACASGSAAVRVGYTAVKSGMADIVLVLGVEKMQESPnpNVIELIGRFGSYFWEfENFGLTFPAYYALHGTAYMMK 158
284161267  81 TRVEAGDASGGVALRQAYMAVASGMHDIVIAAGAEKVTDVP--NAMEILSSSADVEWE-VFNGANLPALYAIIARAHMKK 157
11499992   81 TRVEAADASGGLAVRQAYMAVASGLHDIVIAAGAEKVTDVD--DPMQILSSSVDVEWE-NFVGGSLPALYAIIARLHMDS 157
242398786  80 VKVEAACASGGAAVQEGVKAVMSGLEDVVAVVGVEKMTDAWpsDATRYLAYAADAEWE-LFHGVSFVALNALAMRLYMKE 158
240102517  80 VKIEAACASGGAAVQEGVKAVLSGLEDVVAVVGVEKMTDAWpsDATRYLAYAADAEWE-LFHGASFVALNALIMRHYMKT 158
212224452  77 VKIEAACASGGAAVQEGVKAVLSGLEDVVVVVGVEKMTDAWpsDTTRYLAYAADAEWE-LFHGASFVALNALIMRYYMKT 155
119719675  79 NKVEAACGSGGAAFHNAFLAVKSGLYDCVLAVGVEKLTDATtpDATSALIMAEDQEYV-AFAGFSFVALNALVYKAYMKK 157
16082423   83 VRVEASTASGGAAVREAYLAIKSGEYDVVMVGGVEKMTDIYgsEIIDVQSSILDREWE-SFNGATPAALAAITARRYMHD 161
13540962   84 VRVEASTASGGAAVREAYLAIKSGEYDVVMVGGVEKMTDIYgtEIIDVQSSILDREWE-SFNGATPAAMAAIAARRYMHD 162
48477455   97 IRIEASTASGAAAVHEAYLAIKSGEYNVAVVGGVEKMTDIHghEINEVMSSILDREWE-SFYGATPASMAALIARKYMKD 175
11497899  159 YGATEEDYAKVAVKNHYYGAKNPYAQFQREIDVETVMKSPYVAWPFKLFDCSPITDGSACIILASEEKVKELgI--DEKI 236
284161267 158 YGTKEEDLAMVSVKNHKNATLNPKAMFKREISLEVALNSPYVAEPLKLFDCAPICDGASVVILASEDVAKEY-T--DTPV 234
11499992  158 FGTTEEDLALVSVKNHRNGAKNPKAQFRKEIRVEDVLNSPYVAEPLKLLDCASVSDGAAAVILASEDVAREI-T--DTPV 234
242398786 159 YGYTEEDLALFAVNAHTNGAKNSYAMFKKPITVETVMKSSYVADPIKLFDASPIADGAAAVIITTEEKAKEF-VdkAKIV 237
240102517 159 YGYTEEDLALFAVNAHANGAKNPYAMFKKPIKVETVLKSPYIADPLKLFDASPVCDGAAAVIITTPEKAKELgVpkEKWV 238
212224452 156 YGYTEEDLALFAVNAHANGAKNPYAMFKKPIKVETVLKSPYVADPLKLFDASPVCDGAAALIITTPDKAKELgVpkEKWV 235
119719675 158 YGAKQEDIALFAVHDHKYAVNNPLAQYPRAVTLEEVLSSPMVADPLRLLESAPLGDGAAAALLCSEKKLKEVeK--DVVI 235
16082423  162 FKVPREDIAMIAVNDHANASMNPDAQYRNKITVEQVINSDPVAEPLNVFDCSPISDGASAIILASDEYRKKN-R--LDGI 238
13540962  163 FNVEREAISMVAVNDHANASLNPDAQYRNKITVDQVLNSDPVAEPLNVFDCSPITDGASAIILASEGFVKKNrI---DGV 239
48477455  176 FNIEKEALSMISVNDHENASRNPDAQYRNKISLKQAMESVMVADPLTLMDCSPISDGAAAIVLASEDFVKRN-K--KDGV 252
11497899  237 WILGQGVGTGTANLSRREEFSSLASATYAAEQAYKMAGIDIDDptkyLDGANVHDCFTAPEIIAYEDLRFCKRGEGYKLI 316
284161267 235 YIKACTQASDYIALHSRRDITTMDAVVHASRQAYKIAKIDPKD----VDVAEVHDSFTIAEIMAYEDLGFVEKGRGAELI 310
11499992  235 FIEACTQASDYLALQSRKDILSMRAVVKASRDAYELAGVGPKD----IQVAEVHDSFTIAEILAYEDLGFAEKGKGAELV 310
242398786 238 EVAGMGRAIDTINLANRREFLFLKAAKVAAERAYKMAGISVGD----IDFFEVHDAFTIMAALSLESIGAVERGKGAMLA 313
240102517 239 EVAGMARAIDTINLANREDLLTLKAAKIAAEKAYKMAGVEPKD----IDFFEVHDAFTIMAALSLEALGVAKKGEGAKLA 314
212224452 236 EVAGIGRAIDTINLANREDLLDLKAARVAAQRAYKMAGVEPKD----IDFFEVHDAFTVMAALSLEALGAAERGKGAQLA 311
119719675 236 EVVGSALATDVLSLHDRADLTTLSATVKASRKAYAMAGIEPKD----VDVLEVHDAFTVLGVIHLEDLGFAEKGAGWKLL 311
16082423  239 RIVSSAMSEDYLALHSRKSIYTLESARIASKQALERAGIKKND----ISFLELNDSYSIYGLLELEDLGFAEKGKGRELL 314
13540962  240 RILSSAMAEDYLALHSRKSIYTLESTKIATEEALKKAGIKRED----VSFLELNDSYSIYGLLELEDMGFAEKGKAKDLV 315
48477455  253 KILASAIAEDYLDVGSRKSIYTFNSTKKAARLAFDRAGIKSDD----VSFAEIHDSFSIYGLLALEDLGFADKGNAKDLV 328
11497899  317 REEQTYIGGKIPVNVDGGLKAKGHPIGATGVSQAVEAYKQLLQKAepGRQADINKGRWLAHNVGGTGHYSYVTIYGLEK 395
284161267 311 REGVTALDGDLPVNPSGGLKAFGHAVGATGVRQAVEIVLQLRGDA---GKRQVDAEVGLSLNIGGTGGTAVVTIFSR-- 384
11499992  311 REGVTEIGGKIPVNPSGGLKACGHAVGATGVRQIVELTLQLRGEA---GERQVDAETGLALNIGGTGATAVVSILRR-- 384
242398786 314 KEGQIAIDGDYPIQTLGGLKARGHPVGATGVYQTVEAVWQLRGEA---PNQVPNAEIGLTQNIGGTGSNITVTILRRV- 388
240102517 315 REGQIAIDGDYPIQTMGGLKSRGHPVGATGVYQTVEAVLQLRGEA---PNQVPDAEVGLTQNIGGTGSNITVNILRRV- 389
212224452 312 KEGQIAIDADYPIQTMGGLKARGHPVGATGVYQTVEAVLQLRGEA---PTQVPDAEIGLTQNIGGTGSNITVNILRRV- 386
119719675 312 KEGQLEKDGDLPTNTMGGLKARGHPVGATGIYQIYDIAVQLRGEA--GKNQVDGAEVGLAQNVGGVGGTVSVNILKRVR 388
16082423  315 --GEIKINGSLPVNPSGGLKAKGNPLGATGVSQFYEAYLQLKGKA--GQRQVKGARYGMLHNMAGTGATSVVHIVGE-- 387
13540962  316 -YDDIKLNGRLPVNPSGGLKAKGNPLGATGVSQFFEAYLQLKGKA--GQRQVKDARYALLHNMAGTGATSVVHVVGE-- 389
48477455  329 -YDEIKLSGRIPLNPSGGLKAKGDPYGAVGVGQFVEAYLQLMEKA--GDRQVKSPRYGLLHNMAGTGATSVVHILGD-- 402
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap