Conserved Protein Domain Family
PRK06059

?
PRK06059: PRK06059 
lipid-transfer protein; Provisional
Statistics
?
PSSM-Id: 180373
View PSSM: PRK06059
Aligned: 30 rows
Threshold Bit Score: 568.626
Threshold Setting Gi: 302383133
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
108799981   1 MSPEPVYILGAGMHPWGKWGRDFTEYGVVAARAALAEAGLDWRQIQLVAGADTIRNGYPGFVAGSTFAQKLGWNGVPVTS 80 
224990009   4 SAPEPVYILGAGMHPWGKWGNDFTEYGVVAARAALRDAGVDWRHVQLVAGADTIRNGYPGFVAGATFAQKLGWTGVPVSS 83 
226309120   1 -MSKDVAVLGVGMHPWGKWGQSFVKYGVAAARAALADSGVNWQDVDFIVGGETVRNGYGGYVAGATFAQALGWNGARVAT 79 
119715186   2 SAGRAVAVLGVGMHPWGKWGRPFVEYGVHAARAALADAGVAWGDVDLVVGGETVRNGYGGYVAGATFAQALGWNGARVAT 81 
290961941   1 -MTGEVAVLGAGMHPWGKWGRSFVEYGTVAARAALTDAGVDWRDVCSVVGADTVRGGYPGYVAGASFAKALGWQGARVTS 79 
182439923   1 -MTGDVAVLGAGMHPWGKWGRGFVTYGRIAAHAALADAGIGWPEVRSVVGAQTVRGGYPGYVAGATFARALGWQGARVAS 79 
29833508    1 -MTDDVAVLGAGMHPWGKWGRGFVEYGVAAARAALADAGVDWREVGSIVGADTVRGGYPGYVAGATFAKALGWQGARVTS 79 
271970107   1 ---MSAVILGAGMHPWGKWGRPFVEYGVAAARAALRDAGLAWTDVQFVVGADTLRNGYPGFVAGATFAQAMGWNGARIAS 77 
148556527   1 -MSGEIAILGVGMHPWGKWGRNFVEYGVAAAREALADAGVPWRDVGFVSGGATMRCGYPGYVAGATFAQALGWQGAEVNT 79 
304312369   1 -MSRDVVILGVGMHPWGKWGRNFVEYGVKAARDALKDAGVAWRDVGFVSGAATMRCGYPGYVAGATFAQALGWQGAEVNT 79 
108799981  81 SYAACASGSQALQSARAQILAGFCDVALVIGADTTPKGFFAPVGGERKNDPDWQRFHLIGATNTVYFAMLARRRMDLYGA 160
224990009  84 SYAACASGSQALQSARAQILAGFCDVALVIGADTTPKGFFAPVGGERKGDPDWQRFHLIGATNTVYFALLARRRMDLYGA 163
226309120  80 SYAACATGAQALDTARARILAGLSEVALVVGADTTPKGFLAPVAGERWDDPDWLRFRLMGMTNPAYFALNARRRIDLYGA 159
119715186  82 SYAACATGAQALDAARARILAGLSEVALVVGADTTPKGFLAPNAGERWDDPDWLRFRLLGMTNPAYFALYARRRMDLYGA 161
290961941  80 VYAACASGAQAVGAARAQILAGLADVVLVVGADSAPKGFFRPAGGDRADDPDWLRFRILGATNPTYFGLYARRRMAVHGD 159
182439923  80 VYAACASGAQAIDTARAQILAGLADVVLVVGADAAPKGFFAPAGGERPDDPDWLRFRVLGATNPAYFGLYARRRMALYGD 159
29833508   80 VYAACASGAQAVSAARAQILSGLADVVLVVGADSAPKGFFRPAGGDRPDDPDWLRFRVLGATNPTYFGLYARRRMAVHGD 159
271970107  78 CYAACASGAQAIDIARTRILAGLCDVALVVGADSTPKGFFKPVGGDRPDDPDWLRFRLLGATNPAYFALYARRRMALYGS 157
148556527  80 SYAACASGSQALAAARAKILAGQADVALVVGADTTPKGFLAPAKGERPDDPDWLRFR-VGITNPTYFALYARRRMEAYGD 158
304312369  80 SYAACASGSQALAAARAKIQSGACDVALVVGADTTPKGFLAPQKGERPDDPDWVRFRL-GITNPTYFALYARRRMEMFGD 158
108799981 161 TLEDFAQVKVKNARHGMDNPNARYRKESSVEDVLASPVVSDPLRLLDICATSDGAAALIVASRSFAEKHLGSVEGVPSVR 240
224990009 164 TVEDFAQVKVKNSRHGLDNPNARYRKENSIDDVLASPVVSDPLRLLDICATSDGAAALIVASKSFTEKHLGSVAGVPSVR 243
226309120 160 TAEDFANVKVKNAKHGLNNPNARYRKEVTVENVLASPVVSNPLHLLDICATSDGGAAILLTSMEYARKM--GIAEPVRIK 237
119715186 162 TPEDFARVKVKNARHGLENPNARYRKEVSVEDVLTSAVVSDPLRLLDICATSDGAAAIVLTSADYARRH--GAGSPVRID 239
290961941 160 TPEDFARVKVKNSALGALNPYARYRKPVTAEEVAASAVVADPLRLLDICATSDGGAALVLSSMEFARRH--GVREPVRIR 237
182439923 160 TPEDFALVKVKNAAAGALNEYARYRAPVTAEEVAASAMVADPLRLLDICATSDGAAALVLSSMEFARRR--GVRDPVRIR 237
29833508  160 TVEDFAQVKVKNAASGALNPNARYRKRVTAEEVAASAVVADPLRLLDICATSDGGAALVLSSMEFARRR--GAPDPVRIR 237
271970107 158 TAEDFAAVKVKNALAGSLNGNARYRRTTTAEQVLASPMVADPLRLMDICATSDGGAALVLASDDFARRH--GASSPVRLA 235
148556527 159 TPEDFARVKVKNAEHGFTNPRARYRKKFTMEDVAASAMVADPLRLMDVCATSDGGAALIVSSLDYAKRI--GKGDAPRIA 236
304312369 159 TQDDFALVKVKNAKHGFVNPNARYKKCFTAEDVAASAMVADPLRLMDICATSDGGAAVVIASETYARKL--GVRNAVKIA 236
108799981 241 AVSLQTPQYPQHLPELPDIATDSTAVVPAPERVFKDQILDAAYAEAGIGPEDLSVAEVYDLSTALELDWYEHLGLCPKGE 320
224990009 244 AISTVTPKYPQHLPELPDIATDSTAAVPAPERVFKDQILDAAYAEAGIGPEDLSLAEVYDLSTALELDWYEHLGLCPKGE 323
226309120 238 AISTVTPTFPQTIMDMPNFSTDSSSAVPAPERTFKESIGYAAYEEAGISPEDVDVAEVYDLATSVELDWIEDLALCKRGE 317
119715186 240 AISTVTPTFPNTVLDMPNLATDSSLVVGAPERTFKESIGQAAYDEAGIDPTDVSVAEVYDLSTALELDWMEDLQLCKRGE 319
290961941 238 AVSTVTPRYPNAVLDLPDIATDSAVAVAAPEETFRASIARAAYEEAGVGPEDLSFAEVYDLSTALELQWYEDLALCGEGE 317
182439923 238 AVSTVTPTFPRTVLDLPDIGTDSAVAVDPSPESFRASIARAAYEEAGIGPEDLSLAEVYDLSTALELEWYEDIGLCGPGE 317
29833508  238 AVSTVSPRYPRTVLDLPDIATDSAVAVEPPAETFRTSIARVAYEEAGVGPEDLSLAEVYDLSTALELQWYEDLGLCSEGE 317
271970107 236 AVSTVTPAFPGTVLELPNFATDSTAAVPPPERTFRASIAHAAYEEAGLGPGDLSFAEVYDLSTALELDWVEDVGLCPPGE 315
148556527 237 AISTVTPTFASAIIEMPDLATDSAVAVPA--KSFRAALPAKAYEEAGIGPEDIDVAEVYDLSTALELDWIEDLRLCGRGE 314
304312369 237 AISTVTPTYASAVIEMPDLATDSGAVVEA--HSFRAALPIKAYEEAGLGPKDISVAEVYDLSTALELDWMEDLQLCERGQ 314
108799981 321 AEALLRSGATTIGGRIPVNPSGGLACFGEAIPAQAIAQVCELTWQLKGQATGRQVEGAKVGVTANQGLFGHGSSVVVAR 399
224990009 324 AEALLRSGATTLGGRVPVNPSGGLACFGEAIPAQAIAQVCELTWQLRGQATGRQVADAKVGVTANQGLFGHGSSVIVAR 402
226309120 318 AEHLLRAGDTSIGGRIPVNPSGGLACFGEAVPAQALAQVCELTWQLRGQAEGRQVEGARIGITANQGLFGHGSSVIVSA 396
119715186 320 AEALLRAGETAIGGRIPVNPSGGLACFGEAVPAQALAQVCEVTWQLRGQAGGRQVEGARVGITANQGLFGHGSAVLLSI 398
290961941 318 AAKLLRDGVTALGGRTPVNASGGLASFGEAVPAQAIAQVCELVWQLRGEATDRQVEGARVGVSANQGLFGHGSAVIAVR 396
182439923 318 GAKLLRTGATALGGRVPVNASGGLASFGEAVPAQAVAQVCELARQLRGRAGERQVPGARVGITANQGLFGHGSAVVAVC 396
29833508  318 AAKLLREGATAPGGRIPVNVSGGLASFGEAVPAQAIAQVCELTWQLRGDAGDRQVPGARVGITANQGLFGHGSSVIAVR 396
271970107 316 ADKLLRAGDTALGGRIPVNPSGGLASFGEAVPAQAIAQVCELTWQLRGMAGPRQVAGARAGLAANQGLFGHGSSIIATT 394
148556527 315 AAGLLRDGATRIGGRIPINPSGGLACFGEAVPAQALAQVCELAWQLRGQSGDRQVEGAKVGITANQGLFGHGSSVIVKR 393
304312369 315 AAQLVRDGVTTVGGRLPINPSGGLACFGEAVPAQALAQVCELTWQLRGQSGERQVANAKVGITANQGLFGHGSSVILKR 393
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap