Conserved Protein Domain Family
PRK06025

?
PRK06025: PRK06025 
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 235675
View PSSM: PRK06025
Aligned: 19 rows
Threshold Bit Score: 765.86
Threshold Setting Gi: 27381287
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
85372836    1 MPEAYIVDAVRTPRGIGKVGKGALANEHPQHLAATVLKAIKERNDLDTATVDDVIWSVSTQDGKQAGDMGRMAALDAGYD 80 
197104564   1 MPEALIIDACRTPRGIGKVGKGALADFHPQHLAATVLKALAERNGLKTEEVDDIVWGTSSQRGKQGGDLGRMAALDAGYD 80 
167647581   1 MPEALIIDACRTPRGIGKVGKGALADFHPQHLAATVLKALAERNNLNTAEVDDIIWGTSTQRGKQGGDLGRMAALDAGYD 80 
16124520    1 MAEAYIIDACRTPRGIGKVGKGALADFHPQHLAATVLKALAERNGLNTAEVDDIIWGTSSQRGSQAGDLGRMAALDAGYD 80 
221233205   1 MAEAYIIDACRTPRGIGKVGKGALADFHPQHLAATVLKALAERNGLNTAEVDDIIWGTSSQRGSQAGDLGRMAALDAGYD 80 
146339408   1 MVDALIIDACRTPRGIGKAGKGALAGLHPQHLGATVLRALAERTGIDTGDVDDIIWGCSSQRGPQSGDLGRMSALDAGYD 80 
148254204   1 MVDALIIDACRTPRGIGKAGKGALAGLHPQHLGATVLRALADRTGINTADVDDIIWGCSSQRGPQSGDLGRMSALDAGYD 80 
27381287    1 MADALIIDTCRTPRGVGKAGKGALSGIHPQQLGATVLRALADRTGINTADVDDIVWGCSAQVATQSGDLGRMSALDAGYD 80 
103486731   1 MAEAYIIDAVRTPRGIGKPGKGALSHLHPQHLAATVLKAIRDRNNLDTATVDDIIWSTSSQNGKQGGDLGRMAALSAGYD 80 
103487122   1 MAEAYIIDAVRTPRGIGKPGKGALSHLHPQHLAATVLKAIRDRNNLDTRTVDDIIWSTSTQRGKQGGDLGRMAALSAGYD 80 
85372836   81 VTSSGMTLDRFCGGGITSVNLAAAQVMSGMADCVVAGGTEMMSLTAEMAKAKMQAGiDLPRMGSGNARLQATHPQSHQGV 160
197104564  81 VRASGVTLDRFCGSGITAVNMAAAQIMSGMEDLVIAGGTEMMSYTAATASMQGPDG-GPALIDSGNTRLRARHPQSHQGV 159
167647581  81 TKASGMTLDRFCGSGITTVNLAAASIMSGMEDLVIAGGTEMMSYTAATADRt-----SVGLLDSGNLRLRVRHPQSHQGL 155
16124520   81 VRASGVTLDRFCGSGITTVNLAAASIMSGMEDLVIAGGTEMMSYTSATANVt-----SPPMLDSGNLRLRARHPQSHQGV 155
221233205  81 VRASGVTLDRFCGSGITTVNLAAASIMSGMEDLVIAGGTEMMSYTSATANVt-----SPPMLDSGNLRLRARHPQSHQGV 155
146339408  81 IRASGVTLDRFCGSGITSVNIAAAQIMAGQEDLVVAGGCEMMSMEG-------RRGeGPLMMDAGNLHLRALHPQSHQGV 153
148254204  81 IRASGVTLDRFCGSGITSVNIAAASIMAGQEDLVVAGGCEMMSMEG-------RRGeGPLMMDAGNLHLRALHPQSHQGV 153
27381287   81 VRASAVTLDRFCGSGITSVNMAASSIMAGAEDLVIAGGCEMMSMEG-------RRGgGPMMMDGGNLRLRARHPQSHQGV 153
103486731  81 IKASGTTLDRFCGGGITSVNLAAATVMSGMEDCVVAGGTEMMSYTSAFAAEQANAGlPPRLMGSGHEALDELHPQSHQGV 160
103487122  81 IKASGTTLDRFCGGGITSVNLAAATVMSGMEDCVVAGGTEMMSYTAQLAAEEANAGiKPLGMGAGHAALDELHPQSHQGV 160
85372836  161 CGDAIASMEGFTREELDEVGYRSQQRAAQAIEEGRFDKSIVPVVDDDGNVILDREEFPRPQTTMETLGQLEPAFTKLADI 240
197104564 160 CADAIATMEGITREALDELAYVSQQRADVAIREGRFDRSLVPVYRDDGTVALDREEFPRPQTTREGLAGLKPSFEAMANV 239
167647581 156 CADAIATLEGIPRQALDELALLSQQRADQAIREGRFDRALVPVYRDDGSIALDREEFPRPETTLEGLSSLKAAFEVMAGV 235
16124520  156 CADAIATLEGITRADVDALALESQRRADLAIQGGHFAKSLIPVLRDDGSVALDHEEFPRPQTTAEGLASLKASFAALAEI 235
221233205 156 CADAIATLEGITRADVDALALESQRRADLAIQGGHFAKSLIPVLRDDGSVALDHEEFPRPQTTAEGLASLKASFAALAEI 235
146339408 154 CADAIATMEGITRSDVDALGLESQKRAAAAIAGGHFKKSLVPVHREDGSLALDHEEYPRPQTTAEALAGLKPAFPAIADY 233
148254204 154 CADAIATMEGITRADVDALGLESQKRAAAAIAGGHFKKSLVPVHRDDGSLALDHEEYPRPQTTAEALAGLKPAFPAIADY 233
27381287  154 CADAIATMEGITRRDVDALGLESQKRAAHAIANGHFKKSLVPVHREDGSLALDHEEYPRPQTTMEGLSSLKPAFPAIADY 233
103486731 161 CGDAIATIEGIGREALDALALVSQRRADRAIKEGRFAKSLVPVLNPDGSIALDHEEFPRPETSAEGLAALKPSFAALADF 240
103487122 161 CGDAIAAIEGIDRAAVDALALVSQRRADRAIKEGRFAKSLVPVLNPDGSIALDHEEFPRPETTAEGLAALKPSFDAIADF 240
85372836  241 PLDKKGTTFRGLINQKYPDLEIKHFHHAGNSSGVVDGAAGVLVASKEYCEKHGLKPRARIVATANMGDDPTLMLNAPVPA 320
197104564 240 PLDDKGTTLAGLINQVYPDLKIRHFHHAGNSSGVVDGAAAVLLASPEYAKKNGLKARARVVAMANVGDSPTLMLNAPVPA 319
167647581 236 PIDEAGTTLGGLIQQVYPDLKFNHVHHAGNSSGVVDGAAAVLLASPAYAARNGLKPRARIVAMANMGDSPTLMLNAPVPA 315
16124520  236 PVDEAGNTYGGLIRQVYPDLKIQHMHHAGNSSGVVDGAAAVLLASPAYAQRHGLKPRAKVIAMANVGDSPTLMLNAPVPA 315
221233205 236 PVDEAGNTYGGLIRQVYPDLKIQHMHHAGNSSGVVDGAAAVLLASPAYAQRHGLKPRAKVIAMANVGDSPTLMLNAPVPA 315
146339408 234 ALDDKGTTYRNLILQRYPGLDIQFVHHAGNSSGVVDGAAAILLASPSYAKAHGLKPRARVVAMANMGDDPTLMLNAPVPA 313
148254204 234 ALDDKGTTYRGLILQRYPGLEIEFMHHAGNSSGVVDGAAALLLASPSYAKAHGLKPRARVVAMANMGDDPTLMLNAPVPA 313
27381287  234 ALDDKGTTYRGLILQKYPDLNIDFVHHAGNSSGVVDGAAAILLASPAYAKAHGLKARARVVAMANMGDSPTLMLNAPVPA 313
103486731 241 DM--GGFTFRQQINRRYPDLEIQHFHHAGNSSGVVDGAAALLVTSKAYADKHGLKPRARIVAYANIGDDPTLMLNAPVPA 318
103487122 241 DLG-GGVTFRKQIQRRYPGLEFRGVHHAGNSSGVVDGAAALLVTSKAYADKHGLKPRARIVAYANIGDDPTLMLNAPVPA 319
85372836  321 AKKVLEKAGMTLDDIDLFEINEAFAVVAAKFVRDLDLDWDKVNVNGGAIALGHPIGATGSMLIGTMVDELERQGKTTGMV 400
197104564 320 AKKVLKKAGLTPDDIDLWEINEAFSVVAEKFIRDLNLDREKVNVNGGAMALGHPIGATGSILIGTVIDELERRGLQRGLV 399
167647581 316 ARKALAKAGLTADDIDLWEINEAFAVVAEKFIRDLGLDRDKVNVNGGAMALGHPIGATGSILIGTILDELERRDLKRGLV 395
16124520  316 ARKALAKAGLTVDDIDLWEINEAFAVVAEKFIRDLKLDRDKVNVNGGAMALGHPIGATGSILIGTILDELERRDLKRGLV 395
221233205 316 ARKALAKAGLTVDDIDLWEINEAFAVVAEKFIRDLKLDRDKVNVNGGAMALGHPIGATGSILIGTILDELERRDLKRGLV 395
146339408 314 TRKVLAKAGLTIDDIDLFEINEAFAVVAEKYIRDLKLDRAKVNVNGGSIALGHPIGATGSILIGTLLDELERRDLKRGLV 393
148254204 314 TRKVLAKAGLTLDDIDLFEINEAFAVVAEKYIRDLKLDRAKVNVNGGSIALGHPIGATGSILIGTLLDELERRDLKRGLV 393
27381287  314 TRKVLAKAGLSIDDIDLFEINEAFAVVAEKYIRDLKLDRAKVNVNGGSIALGHPIGATGSILIGTVLDELERRDLKRGLV 393
103486731 319 AKKVLDKAGLTRDDIDVWEINEAFAVVAEKFIRDLDLPRDKVNINGGAMALGHPIGATGSILIGTALDELERSGGRYGLV 398
103487122 320 AKKVLDKAGLTRDDIDVWEINEAFAVVAEKFIRDLDLPRDKVNINGGAMALGHPIGATGSILIGTALDELERSGGRYGLV 399
85372836  401 TMCAAGGMAPAIIVERV 417
197104564 400 TMCAAGGMAPAIIVERV 416
167647581 396 TMCAAGGMAPAVIIERV 412
16124520  396 TMCAAGGMAPAIIIERI 412
221233205 396 TMCAAGGMAPAIIIERI 412
146339408 394 TMCAAGGMAPAIIIERV 410
148254204 394 TMCAAGGMAPAIIIERV 410
27381287  394 TMCAAGGMAPAIIIERV 410
103486731 399 TMCAAGGMAPAIIIERL 415
103487122 400 TMCAAGGMAPAIIIERI 416
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap