Conserved Protein Domain Family
PRK05952

?
PRK05952: PRK05952 
3-oxoacyl-(acyl carrier protein) synthase II; Reviewed
Statistics
?
PSSM-Id: 235653
View PSSM: PRK05952
Aligned: 14 rows
Threshold Bit Score: 553.121
Threshold Setting Gi: 22298164
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
158334259   2 IAKVVVTGMGIVSALAPsLDKTWQRLLCGESGIQHYHPFPEIPAQPLALVGSQPSHLEDLLKPALSEALDDAGLAPPITD 81 
16330682   16 AMGVVVTGLALDTALGD-QLQTWTKLLQGKTAIKPKQPFINLPSFPLALQGNYPRSLGQLVPPLVQAAIDDAQLDPAEQP 94 
113474377   1 -MKVLVTGIGLTSSLGN-LFQSWEKLLDGKSAIRLVKPFAELPPLPLGLINSQPVDLTNLIKQTVETAVKSSGLKLPLPE 78 
166367225   1 -MNVVVTGIGLISSLGN-LSQSWQRLLEGKTGITRQQPFSDLPALPLGLIGHKPAFLEDLTKIALIAALEDAKLTPPLKD 78 
170077623   1 MVRVVITGLGLRCALGD-RHQAWQKLQRGESAIQLRQPFRDLPVIPVAMLGKEPIDLEILRRSLVEATLVDAGLEPPLEH 79 
186683777   1 -MKVLVTGIGLVSALGGsLEDSWKNLIAGKSGIRLHQPFPEIKPLPLGLIAQQPSELAMLTQMVVTSALQDAGLVPPLAD 79 
218437582   1 -MSVVITGVGLISCLGD-LSESWQSLLTGKSGLKLHQPFPALPPRPMGLIGKTPVNLSYLSETVVKAALKQAQLSLPLRD 78 
218246032  10 CIDVVVTGIGLRSCLGN-LKQTWETILQGQSGIKFHQPFPEFPPYPLGLIANQPISLPHLTQLTVTDALTDAQLTAPLPD 88 
220906675   3 AIPVVATGIGLVSALGTtLASNWQRLLKGETGIALHQPFAELPPYPLALIGDRPADLPTLTAEVVQAALVDAQLAPPLAD 82 
257059082  10 CIDVVVTGIGLRSCLGN-LKQTWETILQGQSGIKFHQPFPEFPPYPLGLIANQPISLPHLTQLTVTDALTDAQLTAPLPD 88 
158334259  82 CGVAIGSSRGFQFQWEKGASAYHTSIPSYGEERllladpEQLVHIYGVSPASIVAQSIAAQGPILAPRAACATGIWAIAQ 161
16330682   95 WGVAIGSSRANQCHWEDWVGRNIKPPVAPNFKL------VDWWQTLPDQAARLAAQLLPEVTVMQCPMAACATGLWAIAQ 168
113474377  79 CGVVIGSSRAYQRMLENLAKKQFVDDGQDHSQKd----yGSFINFWPHQPAILTASQIGTKGTVLSPMAACATGILAIAR 154
166367225  79 CGVTIGSSRGCQGLWERMAATGIV---------------ENWLDSLPDRASVLTARLIETGAPVLAPMAACATGIWSIAQ 143
170077623  80 CGIVIGSSRGFQGQWEKLRYDDQQGHQRGL---------ENWLTYLPNQLAIATAQQVGSQGPVLAPMGACTTGLWAIAQ 150
186683777  80 CAVVIGSSRSYQASWEMLARQMYKDTKNLP-VSn----fGNWLDILPHINAIATARQIGATGMVLAPMAACATGIWSIAQ 154
218437582  79 CGVVIGSSRGCQGIWEQGLT-------------------ASWLDTLPHQSAIAAARLIESEGPVLAPMAACATGMWAIAQ 139
218246032  89 CGVVIGSSRGCQGIWEKFAKS--------EPGLd----lSNWLETLPHQAAIIAARQLQTSNIVLSPMAACGTGLLAIFQ 156
220906675  83 CGIVIGSSRGCQAEWEQWARQWHQQGIPPD---------HNWLDRLPHAAAVTAAREVGTRGPVLAPMAACATGLWAVAQ 153
257059082  89 CGVVIGSSRGCQGIWEKFAKS--------EPELd----lSNWLETLPHQAAIIAARQLQTSNIVLSPMAACGTGLWAIFQ 156
158334259 162 GADLIRAGYCSRVIVGAVEAPITPLTLAGFNKMGAMAQSGAYPFDQNREGFVLGEGAAILVLEEESVAQKRQAKIYGQVL 241
16330682  169 GVELIRTGHCQRVLAGAVEAPITPLTLAGFSKMATLAPDGCYPFDRQRQGLVLGEGGALLVLETRELAQKRKARIYGEIL 248
113474377 155 GFELIQTGQCQQVIAGAVESPITPLTIAGFRKMGALAQIGAYPFDRAREGFVLGEGAAILLLESANFAKKRSAKVYGQIR 234
166367225 144 GVELIKMGECDRVLAGAIETPITPLTLVGFEQMGALAKTGCYPFDRAREGLVLGEGGAILVLESEELALSRNAAIYGQIL 223
170077623 151 GFELLQRGDRPQVLAGAVESPVTPLSITGFQKMGALATTGCFPFDQRREGLVLGEGGAIFLLETLESAQQRNAKIYGEIL 230
186683777 155 AALLIQTGQCQQAIAGAVEAPITPLTLAGFQQMGALAKTGAYPFDLQREGLVLGEGAAVFVLESAELAKQRQAKVYGEIL 234
218437582 140 GVELIEQGRCERVIAGAVESPITPLTLASFEKMGALATTGCYPFDKHREGLVLGEGGAVFVLESEALAQGRGASIYGRIL 219
218246032 157 GVELIRQGKCQQIIAGALESPITPLTLAGFERMGVLAKTGCYPFDVQREGLVLGEGGAILVLESAEMAYHRGASIYGQIL 236
220906675 154 GYELLQTGVCERVLVGGVEAAVTRLSLSGFAQMGVLARQGAYPFDRQRQGLVLGEGGAVIVLETAELAQRRGAALYGQVL 233
257059082 157 GVELIRQGKCQQVIAGALESPITPLTLAGFERMGVLAKTGCYPFDVQREGLVLGEGGAILVLESAEVAYHRGASIYGQIL 236
158334259 242 GVGLTVDAYHMTAPETSRRVAITAIQDCLQRSGLKASDVGYIHAHGTATHLNDQAEAVVIKALFPPAVAVSSTKGATGHT 321
16330682  249 GWGFSCDALHRSTPAFDNHSAQQAVKHCLTRSGLTPEQIDLIHPHGTGTLFNDQREAALIQTLFPQNPLITSSKGATGHT 328
113474377 235 SFGLTNDGIHSVIPDLSGKSAMLAIARSLARSGLAPEEIDYVHAHGTATKLNDRHEANLIQQIFPHKVAVSSTKGATGHT 314
166367225 224 GYGFTCDADHVSAPAVDNRSATKAIELCLHRSQLRKDEINYIHAHGTSTRLNDEREANLIASIFGSQVAVSSTKGATGHT 303
170077623 231 GWSFTCDAHHMSAPQGNYQVAMKAIAQCLDWAGLEPENIDHIHPHGTSTRLNDQAEATMIEMLFPHRPFVSGSKGATGHT 310
186683777 235 GFGLTNDAYHSNSPEPEGKSAIAAIKQCLERSCLSPADIDYIHAHGTATQLNDQMESMVIQRLFPQGVAVSSTKGSTGHT 314
218437582 220 GFGLSCDAYHVSTPEPSFKNAAIAVKSCLERSGLQPRDIDYIHTHGTSTQLNDRREAQLIQQLFSHRVGVSSTKGATGHT 299
218246032 237 GFGLTCDGDHISTPSSDNLMAKRAIQQCLDRSNLKRTDIDYIQPHGTSTRLNDQREANLIQALFPSDVPISGTKGATGHT 316
220906675 234 GFGLAADAEHTNAPSQTQAGAIAALKQCLHHSGLTADQVDYIHAHGTATRLNDQFEATLIQNWFPPQVAISSTKGATGHT 313
257059082 237 GFGLTCDGDHISTPSADNLMAKRAIQQCLDRSNLKRTDIDYIQPHGTSTRLNDQREANLIQALFPSDVPISGTKGATGHT 316
158334259 322 LGASAAFGCIFSLMALSHKVLPPCVGLQEPAFDLNFVR----EPHRHNVQSALCLSSGFGGQNTVLALSS 387
16330682  329 LGASGAIAVALTLLSLHQQKLPPCVGLKEPEFPLNFVRiesvQPATSPLNYGLCLSFGFGGQNGAIAVGH 398
113474377 315 LGASGALGAAFCLMAVKHQVLPPCVGLNSPEFDLDLVR----YARQSQVKNVLCLSFGFGGQNAALVLSK 380
166367225 304 LGASGALGVAFCLMALKNQLIPPCVGVRESPFQLNLIR----SAVNFSLHNCLCLSFGFGGQNAAIAVGR 369
170077623 311 LGASGALGVAFSLLMLREQRLFPCVGLEQSEFDLNFVM----KAQNTPLRNALCFSFGFGGQNGAIALQK 376
186683777 315 LGASGALGVAFSLMALKHQILPPCVGLQQPEFDLEIVT----AARLSKIRQVLCLSFGFGGQNVAIALAK 380
218437582 300 LGASGAMALAFCVLALHHQQLPPCVGLRNSDFDLNFIT----QPYQQDVKSVLCFCFGFGGQNAIIALNN 365
218246032 317 LGASGAIAVALGLMALRYQQFPPCVGLKTPEFELNFVR----NSYQTNLKTILCLGFGFGGQNIAIALRG 382
220906675 314 LGAAGAMGLAFCLLALKHQVLFPTVGLQQPDFALNLIQ----QPQLAHLQTLLCFSFGFGGQNAIVAVGN 379
257059082 317 LGASGAIAVALGLMALRYQQFPPCVGLKNPEFELNFVR----NSYQTNLKTILCLGFGFGGQNIAIALRG 382
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap