Conserved Protein Domain Family
PRK05905

?
PRK05905: PRK05905 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 235642
View PSSM: PRK05905
Aligned: 5 rows
Threshold Bit Score: 279.81
Threshold Setting Gi: 26554485
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
13358165    1 MKVKSFAKIDLGYSVYKKQKNFTKHDFESIFILVEN-IYDDIEITKIEKNIDDVHYYNETNEIYVYSRLVH-KTLEWIRH 78 
26554485    4 MIYKSYPKINLFLSIGKKNKKNNLHKLNSVFLLVENsVYDEIKINLNEKEEDEISYFDSTNKTLIIENCIFkKTISYLKE 83 
31544215   22 NHYRSYAKVNFYLKIKEYCPKVKKHKLESKLVLVKD-LYDDLYLEKWNQT--KIKYFDQNNNSLTFSDDILvRTKKFLED 98 
170762347   1 MKVKSFAKIDLGYSVYKKQKNFTKHDFESIFILVEN-IYDDIEITKIEKNIDDVHYYNETNEIYVYSRLVH-KTLEWIRH 78 
209554027   1 MKVKSFAKIDLGYSVYKKRKNITKHDFESIFILVES-VYDDIEIIKIDKNVDDVHYYNETNEIYVYSRLVY-KTLEWIRQ 78 
13358165   79 TYHIKNH--YRINIKKRIPIGAGLGGGSSNAAAIMKYIL-EFEGIKEINYKDVVNKLGADIPFFLSGYKTAYISDYGSVL 155
26554485   84 KEIIDKNlfFKIKIKKNIPLFSGLGSGSSNVACLFKFLL-EIKQINYFQIKKHILNIGSDVLFFIKNYKAAFVYKYGNKV 162
31544215   99 KLNQTFE--FKAKVIKRIPTLSGLGSAPSNAAVLINWIYqEFGILNPVSYYEIATELGSDIPFFLSLHDCAIIKNFGDQV 176
170762347  79 TYHIKNH--YRINIKKRIPIGAGLGGGSSNAAAIMKYIL-EFEGIKEINYKDVVNKLGADIPFFLSGYKTAYISDYGSVL 155
209554027  79 TYRIKNH--YRINIKKRIPIGAGLGGGSSNAAVIMKSIL-ELEGIKEINYKDVVNKLGADIPFFLSGYKTAYVSDCGSTL 155
13358165  156 EDLTGQfKLNYEVYLMNVNVNTKIVFEKFDDNSwHVIKNNFKTIIKNLKENIVVNIHNDLQEYCFELYPNIKYKYNELLS 235
26554485  163 KKVKNP-NLKIKLFFTNIECSTKKVFEDYETNQ-SMCKNSYLKQFLYFKIKRYWMLENDLKESVFNLYKDLSIKHETLQK 240
31544215  177 EQSILDgYETEKIIFNKQKPSTKKIFELLDYSQ--IKKENL----------------NDLEQPFFSLFPELLPSFNQLKN 238
170762347 156 EDLTGQfKLNYEVYLMNVNVNTKIVFEKFDDNSwHVIKNNFKTIIKNLKENIVVNIHNDLQEYCFELYPNIKYKYNELLS 235
209554027 156 EDLSGQfKLSYEVHLMNVNVNTKLVFEKFDDNQwHVIKNNFKTIIKNLKENIVTNIYNDLQEHCFELYPNIRYKYNELLR 235
13358165  236 D-GFYTILSGAGSSFIriklknkedlIINEN 265
26554485  241 KyDKKIFLTGSGGTLF----------LIEDK 261
31544215  239 D-SNHVVLAGAGSCFVvf-------rKLNEI 261
170762347 236 D-GFYTILSGAGSSFIriklknkedlIINEN 265
209554027 236 E-GFYTILSGAGSSFIciklkdkenqVIHEN 265
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap