Conserved Protein Domain Family
PRK05854

?
PRK05854: PRK05854 
short chain dehydrogenase; Provisional
Statistics
?
PSSM-Id: 235627
View PSSM: PRK05854
Aligned: 26 rows
Threshold Bit Score: 487.266
Threshold Setting Gi: 21218788
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
31793442    1 MAKDLVATVPDLSGKLAIITGANSGLGFGLARRLSAAGADVIMAIRNRAKGEAAVEEIRTAVPDAKLTIKALDLSSLASV 80 
118466655   1 MKPNLTLEIPDLRGKFAVVTGANSGLGFGLAKRLAAAGAEVVLAVRDPAKGDQAVAAIRRAVPQAKLTIRQLDLSSLRSV 80 
15609400    1 MAKDLVATVPDLSGKLAIITGANSGLGFGLARRLSAAGADVIMAIRNRAKGEAAVEEIRTAVPDAKLTIKALDLSSLASV 80 
148823468   1 MAKDLVATVPDLSGKLAIITGANSGLGFGLARRLSAAGADVIMAIRNRAKGEAAVEEIRTAVPDAKLTIKALDLSSLASV 80 
148662085   1 MAKDLVATVPDLSGKLAIITGANSGLGFGLARRLSAAGADVIMAIRNRAKGEAAVEEIRTAVPDAKLTIKALDLSSLASV 80 
253798670   1 MAKDLVATVPDLSGKLAIITGANSGLGFGLARRLSAAGADVIMAIRNRAKGEAAVEEIRTAVPDAKLTIKALDLSSLASV 80 
183983345   1 MASDLIATVPDLSGKLAIVTGANSGLGFGLARRLSAAGADVVMAIRNRAKGEAAIEEIRSAVPDAKLSIKALDLSSLASV 80 
118616988   1 MASDLIATVPDLSGKLAIVTGANSGLGFGLARRLSAAGADVVMAIRNRAKGEAAIEEIRSAVPDAKLSTKALDLSSLASV 80 
121638145   1 MAKDLVATVPDLSGKLAIITGANSGLGFGLARRLSAAGADVIMAIRNRAKGEAAVEEIRTAVPDAKLTIKALDLSSLASV 80 
224990639   1 MAKDLVATVPDLSGKLAIITGANSGLGFGLARRLSAAGADVIMAIRNRAKGEAAVEEIRTAVPDAKLTIKALDLSSLASV 80 
31793442   81 AALGEQLMADGRPIDLLINNAGVMTPPERVTTADGFELQFGSNHLGHFALTAHLLPLLRAAqRARVVSLSSLAARRGRIH 160
118466655  81 AALGEQLTAEGRPIDILINNAGVMAPPRRQQTSDGFELQFGTNHLGHFALTGRLLALLRAAdSARVVTVSSIAATQRKLD 160
15609400   81 AALGEQLMADGRPIDLLINNAGVMTPPERVTTADGFELQFGSNHLGHFALTAHLLPLLRAAqRARVVSLSSLAARRGRIH 160
148823468  81 AALGEQLMADGRPIDLLINNAGVMTPPERVTTADGFELQFGSNHLGHFALTAHLLPLLRAAqRARVVSLSSLAARRGRIH 160
148662085  81 AALGEQLMADGRPIDLLINNAGVMTPPERVTTADGFELQFGSNHLGHFALTAHLLPLLRAAqRARVVSLSSLAARRGRIH 160
253798670  81 AALGEQLMADGRPIDLLINNAGVMTPPERVTTADGFELQFGSNHLGHFALTAHLLPLLRAAqRARVVSLSSLAARRGRIH 160
183983345  81 AALGDQLNSEGRPIDILINNAGVMTPPERDTTADGFELQFGSNHLGHFALTAHVLPLLRAAqGARVVSLSSLAARRGRIH 160
118616988  81 AALGDQLNSEGRPIDILINNAGVMTPPERDTTADGFELQFGSNHLGHFALTAHVLPLLRAAqGARVVSLSSLAARRGRIH 160
121638145  81 AALGEQLMADGRPIDLLINNAGVMTPPERVTTADGFELQFGSNHLGHFALTAHLLPLLRAAqRARVVSLSSLAARRGRIH 160
224990639  81 AALGEQLMADGRPIDLLINNAGVMTPPERVTTADGFELQFGSNHLGHFALTAHLLPLLRAAqRARVVSLSSLAARRGRIH 160
31793442  161 FDDLQFERSYAPMTAYGQSKLAVLMFARELDRRSRAAGWGIISNAAHPGLTKTNLQiAGPSHGRDKPALMERLYKtSWRF 240
118466655 161 FADVNAEHGYQPMYSYGVAKLAQLMFAVELDWRSRLGGWGLMSNAAHPGLAKTNLL-SGASYGSSAPTLQARLTRlTWRL 239
15609400  161 FDDLQFERSYAPMTAYGQSKLAVLMFARELDRRSRAAGWGIISNAAHPGLTKTNLQiAGPSHGRDKPALMERLYKtSWRF 240
148823468 161 FDDLQFERSYAPMTAYGQSKLAVLMFARELDRRSRAAGWGIISNAAHPGLTKTNLQiAGPSHGRDKPALMERLYKtSWRF 240
148662085 161 FDDLQFERSYAPMTAYGQSKLAVLMFARELDRRSRAAGWGIISNAAHPGLTKTNLQiAGPSHGRDKPALMERLYKtSWRF 240
253798670 161 FDDLQFERSYAPMTAYGQSKLAVLMFARELDRRSRAAGWGIISNAAHPGLTKTNLQiAGPSHGRDKPALMERLYKtSWRF 240
183983345 161 FDDLQFEKSYAAMTAYGQSKLAVLMFARELDRRSRAAGWGVMSNAAHPGLTKTNLQiSGPSHGREKPALMQRFYTtSWRF 240
118616988 161 FDDLQFEKSYAAMTAYGQSKLAVLMFARELDRRSRAAGWGVMSNAAHPGLTKTNLQiSGPSHGREKPALMQRFYTtSWRF 240
121638145 161 FDDLQFERSYAPMTAYGQSKLAVLMFARELDRRSRAAGWGIISNAAHPGLTKTNLQiAGPSHGRDKPALMERLYKtSWRF 240
224990639 161 FDDLQFERSYAPMTAYGQSKLAVLMFARELDRRSRAAGWGIISNAAHPGLTKTNLQiAGPSHGRDKPALMERLYKtSWRF 240
31793442  241 APFLWQEIEEGILPALYAAATPQADGGAFYGPRGRYEVAGGGVREAKVPAAARNdADSKRLWEVSEQLTGVSYPK 315
118466655 240 LPFMWLDIDEAVKPTLYAAVSPDAQGARYYGPRGFYETARGGVTFARVPPLARSePEMARLWRLSEQLSGVDYPG 314
15609400  241 APFLWQEIEEGILPALYAAATPQADGGAFYGPRGRYEVAGGGVREAKVPAAARNdADSKRLWEVSEQLTGVSYPK 315
148823468 241 APFLWQEIEEGILPALYAAATPQADGGAFYGPRGRYEVAGGGVREAKVPAAARNdADSKRLWEVSEQLTGVSYPK 315
148662085 241 APFLWQEIEEGILPALYAAATPQADGGAFYGPRGRYEVAGGGVREAKVPAAARNdADSKRLWEVSEQLTGVSYPK 315
253798670 241 APFLWQEIEEGILPALYAAATPQADGGAFYGPRGRYEVAGGGVREAKVPAAARNdADSKRLWEVSEQLTGVSYPK 315
183983345 241 APFLWQEIEDGILPALYAAVTPQAEGGAFYGPRGFYEAAGGGVRAAKVPARAGNdADCQRLWEVSERLTGVGYPT 315
118616988 241 APFLWQEIEDGILPALYAAVTPQAEGGAFYGPRGFYEAAGGGVRAAKVPARAGNdADCQRLWEVSERLTGVGYPT 315
121638145 241 APFLWQEIEEGILPALYAAATPQADGGAFYGPRGRYEVAGGGVREAKVPAAARNdADSKRLWEVSEQLTGVSYPK 315
224990639 241 APFLWQEIEEGILPALYAAATPQADGGAFYGPRGRYEVAGGGVREAKVPAAARNdADSKRLWEVSEQLTGVSYPK 315
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap