Conserved Protein Domain Family
fabG

?
PRK05786: fabG 
3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Statistics
?
PSSM-Id: 235608
View PSSM: PRK05786
Aligned: 14 rows
Threshold Bit Score: 285.117
Threshold Setting Gi: 145591309
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18311661    1 MRLKGRNIAIVGVGPGLGSAVVYMALREGAAVYAFARSAEFLERLkAEYSKYGVLHVSPKDFSRLEEAERAREEVRRVFP 80 
145591309  13 MRLVQKNVVVVGVGPGLGSAVAYMALREAASVYAFARRPEALAGL-QWLAQHGKVYLSARDFAKLDQALAAAEEARKVFP 91 
70606041    1 MRLKGRRVLIAGTSTGLGYAVAYFSINEGAEVVLNARSEKKLVEIvKSLGD--KASYVVGDVSTPQGARDVVSRAGN--- 75 
15922619    1 MRLKGRRVLIVGVSKGLGYALAYFLLKEGASVVINSRNEEKLKEIkKSLESIGEITYVVGDVSTLEKAREVVEKAGNF-- 78 
229580744   2 GRLDNKKVAIIGVSEGLGYATAYFALKEGAQVCINSRNENKLKRMkKTLSKYGNIHYVVGDVSSTDSARNVIDKCASLLN 81 
284996429   2 GRLDNKKVAIIGVSEGLGYATAYFALKEGAQVCINSRNENKLKRMkKTLSKYGNIHYVVGDVSSTDSARNVIDKCASLLN 81 
227826433   2 GRLDNKKVAIIGVSEGLGYATAYFALKEGAQVCINSRNENKLKRMkETLSKYGNIHYVVGDVSSTDSARNVIDKCASLLN 81 
229583595   2 GRLDNKKVAIIGVSEGLGYATAYFALKEGAQVCINSRNENKLKRMkETLSKYGNIHYVVGDVSSTDSARNVIDKCASLLN 81 
227829042   2 GRLDNKKVAIIGVSEGLGYATAYFALKEGAQVCINSRNENKLKRMkKTLSKYGNIHYVVGDVSSTDSARNVIDKCASLLN 81 
229577840   2 GRLDNKKVAIIGVSEGLGYATAYFALKEGAQVCINSRNENKLKRMkKTLSKYGNIHYVVGDVSSTDSARNVIDKCASLLN 81 
18311661   81 ELHGLVVTAGCYTSQPVEELgeAELEDMLNKNLKAHIYAVRAFLPLMGRGSSIVLISSVGGAYKAWPRHVAYVAAKAATA 160
145591309  92 AVHGLVVTAGGYTSQPVEEVgeAELEDMLSKNLKAHIYAVRAFAPLLAPGSSVVLVSSVGGAYKAWPRHVAYVASKAAVA 171
70606041   76 -ITDLVITVGGYLEDTVESP--SGLDEMLKNHIKTPLYLVNASLEKLHEGSTIVMVSSTRALYTALPNQLSYAIAKSGLT 152
15922619   79 --TDLVVTVGGYIEDTVEDL--KALDEMINNHIKIPLYVVHYSLSKLKEGSTIVLVSAIRGIYTAYPTQLSYAVGKAGLA 154
229580744  82 GIDHLVVTVGGYVEDTIDNF--SGLEEMLTNHIKIPLYVINSSIRFLKEGSSVVLVSSMSGIGKASPDQLSYAVAKAGLA 159
284996429  82 GIDHLVVTVGGYVEDTIDNF--SGLEEMLTNHIKIPLYVINSSIRFLKEGSSVVLVSSMSGIGKASPDQLSYAVAKAGLA 159
227826433  82 GIDHLVVTVGGYVEDTIDNF--SGLEEMLTNHIKIPLYVINSSLRFLKEGSSVVLVSSMSGIGKASPDQLSYAVAKAGLA 159
229583595  82 GIDHLVVTVGGYVEDTIDNF--SGLEEMLTNHIKIPLYVINSSLRFLKEGSSVVLVSSMSGIGKASPDQLSYAVAKAGLA 159
227829042  82 GIDHLVVTVGGYVEDTIDNF--SGLEEMLTNHIKIPLYVINSSIRFLKEGSSVVLVSSMSGIGKASPDQLSYAVAKAGLA 159
229577840  82 GIDHLVVTVGGYVEDTIDNF--SGLEEMLTNHIKIPLYVINSSIRFLKEGSSVVLVSSMSGIGKASPDQLSYAVAKAGLA 159
18311661  161 RAAEALAAELLERGIRVNAVAPGGMAKDFQPGRSYTV--ALGAPQAPPEEVAKVVIWLLTDEASWVTGAVIPADGGRRLL 238
145591309 172 KAAEALAAELLERGVRVNAVAPGGMTKDFQPGRRYEV--KLGAPQVPPEEVAKVVIWLLTDEARWVTGAVIPVDGGRRLL 249
70606041  153 KAVEILASELLNKGIRVVGVAPSFIMGDFVPGRDWRKmrKLGDAGAPPEDFAQVITWLLSNEAQWVNGVVIPVDGGARLK 232
15922619  155 KEVEILASELLSRGIRVVGIAPSFIDGDFVPDRDWKKlrKLGDFKAPPEDFARVIVWLLTEEAEWVNGVVIPVDGGARLK 234
229580744 160 KEVEILASELLGRGIRVNGIAPTTISGEFEPERNWKKlrKLGDDMAPPEDFARIIIWLLTDESDWVDGVVIPAHGGARLK 239
284996429 160 KEVEILASELLGRGIRVNGIAPTTISGEFEPERNWKKlrKLGDDMAPPEDFARIIIWLLTDESDWVDGVVIPAHGGARLK 239
227826433 160 KEVEILASELLGRGIRVNGIAPTTISGEFEPERNWKKlrKLGDDMAPPEDFARIIIWLLTDESDWVDGVVIPAHGGARLK 239
229583595 160 KEVEILASELLGRGIRVNGIAPTTISGEFEPERNWKKlrKLGDDMAPPEDFARIIIWLLTDESDWVDGVVIPAHGGARLK 239
227829042 160 KEVEILASELLGRGIRVNGIAPTTISGEFEPERNWKKlrKLGDDMAPPEDFARIIIWLLTDESDWVDGVVIPAHGGARLK 239
229577840 160 KEVEILASELLGRGIRVNGIAPTTISGEFEPERNWKKlrKLGDDMAPPEDFARIIIWLLTDESDWVDGVVIPAHGGARLK 239
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap