Conserved Protein Domain Family
flgE

?
PRK05682: flgE 
flagellar hook protein FlgE; Validated
Statistics
?
PSSM-Id: 235557
View PSSM: PRK05682
Aligned: 317 rows
Threshold Bit Score: 287.502
Threshold Setting Gi: 161777623
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 104782843   1 MSFNIGLSGLYAANKQLDVTGNNIANVNTNGFKSSRAEFADVYAGAnrl---------gvGKNQVGNGVRLANVSQQFGQ 71
gi 189025952   3 RSLFSGVSGMQNHQTRMDVIGNNVANVNTTGFKRGRVNFQDLISQQlsaaarpneevggvNPKEVGLGVLIASIDTVHTQ 82
gi 24215548    3 RSLYSGVSGLKNHQVRMDVIGNNISNVNTHGFKTERVTFQDMISQElrgasepkeniggvNPQQVGLGSLIAAIDKIMTQ 82
gi 45657072    3 RSLYSGVSGLKNHQVRMDVIGNNISNVNTHGFKTERVTFQDMISQElrgasepkeniggvNPQQVGLGSLIAAIDKIMTQ 82
gi 116328901   3 RSLYSGVSGLKNHQVRMDVIGNNISNVNTHGFKTERVTFQDMISQElrgasepkeniggvNPQQVGLGSLIAAIDKIMTQ 82
gi 116330492   3 RSLYSGVSGLKNHQVRMDVIGNNISNVNTHGFKTERVTFQDMISQElrgasepkeniggvNPQQVGLGSLIAAIDKIMTQ 82
gi 189910695   3 RSLYSGVSGLKNHQVRMDVIGNNISNVNTHGFKTERVTFQDMISQElqgasepneriggtNPKQVGLGSLIAAIDKIMTQ 82
gi 183220587   3 RSLYSGVSGLKNHQVRMDVIGNNISNVNTHGFKTERVTFQDMISQElqgasepneriggtNPKQVGLGSLIAAIDKIMTQ 82
gi 300870390   3 RSLFAGVSGLQNHQTRMDVVGNNISNVNTYGFKKGRVTFKDMISQSlsgaakpqedrggiNPQQVGLGMQVATIDTIHTQ 82
gi 296126058   3 RSLFAGVSGLQNHQTRMDVVGNNIANVNTYGFKRGRVTFKDMISQSlsgaakpqedrggiNPQQVGLGMMVATIDTIHTQ 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 104782843  72 GDVNNTGNVLDMGIQGQGFFVLSDNGSL--SYSRAGAFQTNKDNFVVTSDGL-RLQGYAAd--ANGKIQK-----GVLTD 141
gi 189025952  83 GALQTTGINTDVSIQGSGFFVLk-SG-EktFFTRAGAFGVDNAGTLVNPANGmRVQGWMAq--DVAGERLin-ssAQTQD 157
gi 24215548   83 GSLQTTGKNTDVAISGEGFFIVkDGDKQ--FYTRAGAFNLDKNGYYVNPANGlKVQGWNSr--LDDKGNKyinsaASIED 158
gi 45657072   83 GSLQTTGKNTDVAISGEGFFIVkDGDKQ--FYTRAGAFNLDKNGYYVNPANGlKVQGWNSr--LDDKGNKyinsaASIED 158
gi 116328901  83 GSLQTTGKNTDVAMSGEGFFIVkDGDKQ--FYTRAGAFNLDKNGYYVNPANGlKVQGWNAr--LDDKGNKfinssASIED 158
gi 116330492  83 GSLQTTGKNTDVAMSGEGFFIVkDGDKQ--FYTRAGAFNLDKNGYYVNPANGlKVQGWNAr--LDDKGNKfinssASIED 158
gi 189910695  83 GALQTTGKNTDLAVSGEGFFVVkDGDKQ--FYTRAGAFNVDKNGFYVNPANGlKVQGWNSr--LDESGNKyinsaGSLED 158
gi 183220587  83 GALQTTGKNTDLAVSGEGFFVVkDGDKQ--FYTRAGAFNVDKNGFYVNPANGlKVQGWNSr--LDESGNKyinsaGSLED 158
gi 300870390  83 GALQVTGVNTDLAIQGEGFFIEKKGNSS--YYTRNGAFSIDKNGYLVNPSNGyKVQGWNAvlnPETGMMEln-taAGVED 159
gi 296126058  83 GALQVTGVNTDLAIQGEGFFIEKRGNNS--YYTRNGAFSLDRDGYLVNPSIGyKVQGWNAvlnPETGEMEln-taAGVED 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 104782843 142 LKIDTSALAPKSTT-LID-QGINLNSSALdiplqvwdatatppamvpnkpfdptDRTTYSDSF--------------PTK 205
gi 189025952 158 LVIPIGQKIDAQQT-STVhYACNLDKRLPel------------------------------aAdaneadvrkstwttDFQ 206
gi 24215548  159 IIIPVYSKEPARAT-SQIdFKSNLNSSAPavppdatqee------itamindpdPKMRRGHVT--------------TIN 217
gi 45657072  159 IIIPVYSKEPARAT-SQIdFKSNLNSSAPavppdatqee------itamindpdPKMRRGHVT--------------TIN 217
gi 116328901 159 IIIPVYSKEPARATsQID-FKSNLNSSAPavppdatqee------itamindpdPKMRRGHVT--------------TIK 217
gi 116330492 159 IIIPVYSKEPARAT-SQIdFKSNLNSSAPavppdatqee------itamindpdPKMRRGHVT--------------TIK 217
gi 189910695 159 IVIPLYSKEPARAT-QNVdFQSNLNASVAavppdateed------iqryindpdPRQRRGHVT--------------SIN 217
gi 183220587 159 IVIPLYSKEPARAT-QNVdFQSNLNASVAavppdateed------iqryindpdPRQRRGHVT--------------SIN 217
gi 300870390 160 LIIPVGSKDPARAT-QNTkFFCNLQKNSD------------------------------THQA--------------DLT 194
gi 296126058 160 LIIPVGSKDPARAT-ANTkYFCNLQKSGE------------------------------THQS--------------DLT 194
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 104782843 206 VYDSQGNEHVMEQ-FY-RKTGt-NEWTMYTLVDGrnpftpgaaa-----pagttpltgtINFNPDGSVkn---------- 267
gi 189025952 207 VYDSFGQQHTLQI-NFsRVpgtnNQWQATVAVDPgtevdtqtrvgv--gtsdgaantfiVNFDNFGHLasvtdtagnvtg 283
gi 24215548  218 TFDDQGIQREFKMeFYkVRd---NTWKARLSMTDstqlsvdvsgtggqntqlpgnteleFGFTPDGKLvyvs-------- 286
gi 45657072  218 TFDDQGIQREFKM-EF-YKVRd-NTWKARLSMTDstqlsvdvsgtggqntqlpgnteleFGFTPDGKLvyvs-------- 286
gi 116328901 218 TFDDQGIQREFKM-EF-YKVRd-NTWKARLSMTDatqlsadvsgtggqntqlpgnteleFGFTPDGKLvyvs-------- 286
gi 116330492 218 TFDDQGIQREFKMeFYkVRd---NTWKARLSMTDatqlsadvsgtggqntqlpgnteleFGFTPDGKLvyvs-------- 286
gi 189910695 218 VYDELGNTRQMGV-EF-YKMRe-NVWKMRFKLEDasqvsvdvngtggentsvsgnteleVSFTPDGKIisvs-------- 286
gi 183220587 218 VYDELGNTRQMGV-EF-YKmr-eNVWKMRFKLEDasqvsvdvngtggentsvsgnteleVSFTPDGKIisvs-------- 286
gi 300870390 195 IYDSTGIPRQLRA-TF-NRTDv-NRWDMVIEIPEategsvsvsagd--pvenggnntfqLVFNDAGSLisvs-------- 261
gi 296126058 195 IYDSTGIPRQLRA-TF-TRTDv-NRWDMTIDIPDategsvsvsagd--pvegggnntfqLVFNDAGSLisvs-------- 261
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 104782843 268 -----mSTAATGVPTTpagqfewsvtnnifsmkgwvpaakdaagnwasngavgnADGMRLSM------NSTTSYNTATAr 336
gi 189025952 284 ptgqvlLEASYDVVGAnpddag---------------------------qvtrhAFTLNL-----------GEIGTARNt 325
gi 24215548  287 ---dgvDSMNSGKLNAkvsfri---------------------------pgnpaIQNFDLNLgeagmvNGITQFSSDFTt 336
gi 45657072  287 --dgvdSMNSGKLN-Akvsfri---------------------------pgnpaIQNFDLNLgeagmvNGITQFSSd--- 333
gi 116328901 287 --dgvdSMNSGKLN-Akvsfri---------------------------agnpaVQSFDLNLgeagmvDGITQFSS--Df 334
gi 116330492 287 ---dgvDSMNSGKLNAkvsfri---------------------------agnpaVQSFDLNLgeagmvDGITQFSSDFTt 336
gi 189910695 287 --dgvdSQTTGKLK-Adisfri---------------------------pgnpsAQKFSLNLgeaglvGGITQFSSd--- 333
gi 183220587 287 ---dgvDSQTTGKLKAdisfri---------------------------pgnpsAQKFSLNLgeaglvGGITQFSSDFTt 336
gi 300870390 262 ---dgtNTQTEGVLMPnvsftyt-------------------------gtdgevNQTINLTMgevglfNGITQFESPSTt 313
gi 296126058 262 ---dgtNTQTEGVLMPnvsftyq-------------------------gtegevNQTINLTMgevglfNGITQFESPSTt 313
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 104782843 337 --------MS--QSQDGYATGILSNLSIDSTGVMFASFSNQQSRAIGQVAIASFANPQGLQQIGGTRWKESFASGIPGID 406
gi 189025952 326 itqfaersTTkaYRQDGYAMGYLENFKIDQSGVITGVYSNGVSQDIGQLALAGFANQGGLEKAGENTYVQSNNSGIANIS 405
gi 24215548  337 --------KA--VKQDGYTMGYLESFSIDNSGTITGVFSNGVRQPLARVATAVFNNPAGLDKAGDTMFSYSMNSGEPNIG 406
gi 45657072  334 -------fTTkaVKQDGYTMGYLESFSIDNSGTITGVFSNGVRQPLARVATAVFNNPAGLDKAGDTMFSYSMNSGEPNIG 406
gi 116328901 335 --------TTkaVKQDGYTMGYLESFSIDNSGTITGVFSNGVRQPLARIATAVFNNPAGLDKAGDTMFAYSMNSGEPNIG 406
gi 116330492 337 --------KA--VKQDGYTMGYLESFSIDNSGTITGVFSNGVRQPLARIATAVFNNPAGLDKAGDTMFAYSMNSGEPNIG 406
gi 189910695 334 -------fTTkaVKQDGYPMGYMESFSIDNTGTVTGVFSNGVRQPLARVALANFTNPAGLNKEGDTMYSFSLNSGEANIG 406
gi 183220587 337 --------KA--VKQDGYPMGYMESFSIDNTGTVTGVFSNGVRQPLARVALANFTNPAGLNKEGDTMYSFSLNSGEANIG 406
gi 300870390 314 --------KA--IEQDGYTMGMLEGFSFDDSGQITGVFTNGNRKTLGQVALAKFANAGGLEKAGDTLFVESNNSGAANIG 383
gi 296126058 314 --------KA--IEQDGYTMGMLEGFSFDDSGQITGVFTNGNRKTLGQVALAKFNNAGGLEKAGDTLFVASNNSGAANIG 383
                        490       500       510       520       530
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 104782843 407 APKTGTLGSVESNSLEASNVNLTQELVELIKAQSNYQANAKTISTESTIMQTIIQMT 463
gi 189025952 406 TSGVMGKGKLIAGTLEMSNVDLTDQFTDMIITQKGFQAGAKTIQTSDTMLDTVLSLK 462
gi 24215548  407 EAGVQGRGKINAGLLEMSNVDLSDQFTDMIVTQRGFQANSRTITTSDQMIQEVLGLK 463
gi 45657072  407 EAGVQGRGKINAGLLEMSNVDLSDQFTDMIVTQRGFQANSRTITTSDQMIQEVLGLK 463
gi 116328901 407 EAGVQGRGKINAGLLEMSNVDLSDQFTDMIVTQRGFQANSRTITTSDQMIQEVLGLK 463
gi 116330492 407 EAGVQGRGKINAGLLEMSNVDLSDQFTDMIVTQRGFQANSRTITTSDQMIQEVLGLK 463
gi 189910695 407 EAGSQGRGKINAGLLEMSNVDLSDQFTDMIVTQRGFQANSRTIVTSDQMIQEVLGLK 463
gi 183220587 407 EAGSQGRGKINAGLLEMSNVDLSDQFTDMIVTQRGFQANSRTIVTSDQMIQEVLGLK 463
gi 300870390 384 VAAAEGRGSIKAGTLEMSNVDLSEQFTDMIVTQRGFQANARTITTADQLLQEVIALK 440
gi 296126058 384 TAAAEGRGSLKAGALEMSNVDLSEQFTDMIVTQRGFQSNARTITTADQMLQEVIALK 440
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap