Conserved Protein Domain Family
flgC

?
PRK05681: flgC 
flagellar basal body rod protein FlgC; Reviewed
Links
?
Statistics
?
PSSM-Id: 235556
View PSSM: PRK05681
Aligned: 295 rows
Threshold Bit Score: 160.76
Threshold Setting Gi: 15639388
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 224373713   1 MGFFNSFDISGYGLSAQRFRINIISENIANANTTRTDE-GGPYRRKEVIFKAvpfeeqlnqeieqnskfhqyenpldeEg 79
gi 222147569   8 DPLTSALKIAGSGLDVQSTRLRIVSENIANAQSTGDTPgANPYRRKTITFGS--------------------------Em 61
gi 227820856   2 DPLTSALKVSASGLQAESTRLRIVSENIANARSTGDVPgADPYRRKTISFAA--------------------------Ev 55
gi 58039961    1 MNLSTTIGISASGMDAQAQRLRIVAENLANQDTTGSQPgADPYRRKTITFAE--------------------------Hv 54
gi 15964413    2 DPLTSALKVSASGLQAESTRLRIVSENIANARSTGDAPgADPFRRKTISFAA--------------------------Ev 55
gi 150395483   2 DPLTSALKVSASGLQAESTRLRIVSENIANARSTGDAPgTDPYRRKTISFAA--------------------------Ev 55
gi 13472574    2 DALTAALKVAASGLGAQSERLRVVSENLANAQSTGTTPgADPYRRKTISFVS--------------------------El 55
gi 162147439   1 MDFSDTIGVSAAGMRAQEERLRVAAENLANKDTTGSTRgADPYRRKTITFQA--------------------------Tl 54
gi 209545549   1 MDFSDTIGVSAAGMRAQEERLRVAAENLANKDTTGSTRgADPYRRKTITFQA--------------------------Tl 54
gi 110632658   2 DPLSTAVKIAGSGLAAQSERMRVVSENLANAQSTSEVPgGDPYRRKTISFAA--------------------------El 55
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 224373713  80 ENYAVakppIETVVVDKVVRDDSKPILKYDPSNPDADANGYVAYPNINPVIEMADLLEATRAYQANVAAFQSAKTMANSA 159
gi 222147569  62 DRATG----TEIVKVKKLGFDKSNFTEEYDPSNPAADAKGYVKMPNVNVLIEMADMREANRTYEANLQSVKQTRDLITST 137
gi 227820856  56 DRASG----ASLVEVQRLGTDDSDFSIEFDPGNPAADEKGMVKMPNVNVLIEMADMREANRAYEANLQTVKQSRDLISQT 131
gi 58039961   55 DDETG----ASTVDVQNVGQDMSDFDTRYDPSHPAADERGYVKVSNVDSMTEMMDMREAERSYEANLNALSSTRTMLSRT 130
gi 15964413   56 DRASG----ASLVEVERLGTDDSDFNIEFDPGNPAADEKGMVKLPNVNILIEMADMREANRAYEANLQTIKQSRDLISQT 131
gi 150395483  56 DRASG----ASLVEVERLGTDDSDFNVEFDPGNPAADEKGMVKLPNVNILIEMADMREANRAYEANLQTIKQARDLISQT 131
gi 13472574   56 DRASG----ASTVEVNSIDRDPSVFPVEFQPGNEAADEKGYVKMPNVNVLIEMADMTEANRSYEANLQVVKQARDLISMT 131
gi 162147439  55 DQASG----VSSVKVKGIGQDNTPFQTKYDPSHPAADANGYVKMPNVNSMVEIMDTHEAQHSYEANLNTMQISRSMATRT 130
gi 209545549  55 DQASG----VSSVKVKGIGQDNTPFQTKYDPSHPAADAKGYVKMPNVNSMVEIMDTHEAQHSYEANLNTMQISRSMATRT 130
gi 110632658  56 GRGNG----GAMVEVSAIARDPAEFPVEYMPGHEAADEFGYVKMPNVNMLVEMADMREANRGYEANLQVVKQARELISMT 131

                 ....*
gi 224373713 160 INILQ 164
gi 222147569 138 LDLLK 142
gi 227820856 132 IDLLR 136
gi 58039961  131 LDLLK 135
gi 15964413  132 IDLLR 136
gi 150395483 132 IDLLR 136
gi 13472574  132 IDLMR 136
gi 162147439 131 INLIK 135
gi 209545549 131 INLIK 135
gi 110632658 132 IDLLR 136
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap