Conserved Protein Domain Family
PRK05656

?
PRK05656: PRK05656 
acetyl-CoA acetyltransferase; Provisional
Statistics
?
PSSM-Id: 168156
View PSSM: PRK05656
Aligned: 22 rows
Threshold Bit Score: 701.26
Threshold Setting Gi: 226947138
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116049952   1 MQDVVIVAATRTAVGSFQGSLAGIPAPELGAAVIRRLLEQTGLDAGQVDEVILGQVLTAGSGQNPARQAAIKAGLPVGVP 80 
15597197    1 MQDVVIVAATRTAVGSFQGSLAGIPAPELGAAVIRRLLEQTGLDAGQVDEVILGQVLTAGSGQNPARQAAIKAGLPVGVP 80 
152986462   1 MQDVVIVAATRTAVGSFQGSLAGIPAPELGAAVIRRLLEQTGLDAGQVDEVILGQVLTAGSGQNPARQAAIKAGLPVGVP 80 
218892041   1 MQDVVIVAATRTAVGSFQGSLAGIPAPELGAAVIRRLLEQTGLDAGQVDEVILGQVLTAGSGQNPARQAAIKAGLPVGVP 80 
229589647   1 MQDVVIVAATRTAVGSFQGSLATIPAPELGAAVIRRLLEQTGLDPAEVDEVILGQVLTAGSGQNPARQASILAGLPHAVP 80 
146308612   1 MQDVVIVAATRTAIGSFQGSLAEIPAPELGAIVIKRLLEQTGLDAAQVDEVILGQVLTAGSGQNPARQAAIRAGLPHAVP 80 
146306172   1 MQDVVIVAATRTAIGSFQGSLAEIPAPELGAIVIKRLLEQTGLDAAQVDEVILGQVLTAGSGQNPARQAAIRAGLPHAVP 80 
146281079   1 MIDVVIVAATRTAIGSFQGSLAEIPAPELGAIVIRRLLEQTGLDAAQVDEVILGQVLTAASGQNPARQAVIRAGLPHVVP 80 
146283545   1 MQDVVIVAATRTAIGSFQGSLANVPAVELGATVIRALLEKTGIDPTQVDEVILGQVLTAGAGQNTARQASIKAGLPHAVP 80 
28868177    1 MQDVVIVAATRTAVGSFQGSLAAVPAVDLGAAVIRQLLAQTGVDGALVDEVIMGQVLTAGAGQNPARQAAIKAGLPFSVP 80 
116049952  81 AMTLNKVCGSGLKALHLGAQAIRCGDAEVIVAGGQENMSLAPYVMPGARTGLRMGHAKLVDSMIEDGLWDAFNDYHMGIT 160
15597197   81 AMTLNKVCGSGLKALHLGAQAIRCGDAEVIVAGGQENMSLAPYVMPGARTGLRMGHAKLVDSMIEDGLWDAFNDYHMGIT 160
152986462  81 AMTLNKVCGSGLKALHLGAQAIRCGDAEVIVAGGQENMSLAPYVMPGARTGLRMGHAKLVDSMIEDGLWDAFNDYHMGIT 160
218892041  81 AMTLNKVCGSGLKALHLGAQAIRCGDAEVIVAGGQENMSLAPYVMPGARTGLRMGHAKLVDSMIEDGLWDAFNDYHMGIT 160
229589647  81 SLTLNKVCGSGLKALHLGAQAIRCGDADVIIAGGMENMSLAPYVLPAARTGLRMGHAKMIDSMITDGLWDAFNDYHMGIT 160
146308612  81 AMTLNKVCGSGLKALHLATQAIRCGDAEVIIAGGMENMSLAPYVLPKARTGLRMGHAQLQDSMILDGLWDAFNDYHMGIT 160
146306172  81 AMTLNKVCGSGLKALHLATQAIRCGDAEVVIAGGMENMSLAPYVLPKARTGLRMGHAQLQDSMILDGLWDAFNDYHMGIT 160
146281079  81 AMTLNKVCGSGLKALHLAAQAIRCGDAEVIIAGGMENMSLSPYVLPKARTGLRMGHAQMLDSMIVDGLWDAFNDYHMGIT 160
146283545  81 SMTLNKVCGSGLKAVHLAVQAIRCGDAEVVIAGGMENMSLAPYVLPGARTGLRMGHAQIVDTMITDGLWDAFNDYHMGIT 160
28868177   81 AMTLNKVCGSGLKTLHLATQAIRCGDADIVIAGGQENMSLSNYVLPGARTGLRMGHASMIDTMITDGLWDAFNDYHMGIT 160
116049952 161 AENLAEKYGLTREEQDAFAAASQQKAIAAIEGGRFRDEITPIQVPQRKGEPLSFDTDEQPRAGTTVEALAKLKPAFRKDG 240
15597197  161 AENLAEKYGLTREEQDAFAAASQQKAIAAIEGGRFRDEITPIQVPQRKGEPLGFDTDEQPRAGTTVEALAKLKPAFRKDG 240
152986462 161 AENLAEKYGLTREEQDAFAAASQQKAIAAIEGGRFRDEITPIQVPQRKGEPLSFDTDEQPRAGTTVEALAKLKPAFRKDG 240
218892041 161 AENLAEKYGLSREEQDAFAAASQQKAIAAIEGGRFRDEITPIQVPQRKGEPLSFDTDEQPRAGTTVEALAKLKPAFRKDG 240
229589647 161 AENLVDKYGISREAQDAFAAASQQKAVAAIEAGRFADEITPILIPQRKGDPVAFAVDEQPRAGTTAESLAKLKPAFKKDG 240
146308612 161 AENLVEKYGISREAQDAFAAASQQKAVAAIESGRFDAEITPVLIPQRKGDPIAFARDEQPRAGTTAESLAKLKPAFKKDG 240
146306172 161 AENLVEKYGISREAQDAFAAASQRKAVAAIESGRFDTEITPVLIPQRKGDPVAFARDEQPRAGTTAESLAKLKPAFKKDG 240
146281079 161 AENLVDKYGISREAQDAFAAASQQKAVAAIEAGRFDAEITPVLIPQRKGDPIAFARDEQPRAGTTAESLAKLKPAFKKDG 240
146283545 161 AENLADKYGIDRAQQDAFAAQSQQRAAAAIESGRFDAEITPVMIPQRKGDPVAFARDEQPRAGTTAESLGGLRAAFKKDG 240
28868177  161 AENLAQKYEISREAQDAFAALSQQKAIAAIEAGRFVDEITPILIPQRKGEPLSFATDEQPRAGTTAETLGKLKPAFKKDG 240
116049952 241 SVTAGNASSLNDGAAAVLLMSAAKAKALGLPVLARIASYASAGVDPAIMGIGPVSATRRALDKAGWSLEQLDLIEANEAF 320
15597197  241 SVTAGNASSLNDGAAAVLLMSAAKAKALGLPVLARIASYASAGVDPAIMGIGPVSATRRALDKAGWSLEQLDLIEANEAF 320
152986462 241 SVTAGNASSLNDGAAAVLLMSAAKAKALGLPVLARIASYASAGVDPAIMGIGPVSATRRALDKAGWSLEQLDLIEANEAF 320
218892041 241 SVTAGNASSLNDGAAAVLLMSAAKAKALGLPVLARIASYASAGVDPAIMGIGPVSATRRALDKAGWSLEQLDLIEANEAF 320
229589647 241 SVTAGNASSLNDGAAAVLLMSADKAKALGLPVLARIASYANAGVDPAIMGIGPVSATRRCLDKAGWSLGDLDLIEANEAF 320
146308612 241 SVTAGNASSLNDGAAAVLLMSASKAQSLGLPVLAKIAGYANAGVDPAIMGIAPVSATRRCLDKAGWSLADLDLIEANEAF 320
146306172 241 SVTAGNASSLNDGAAAVLLMSASKAQSLGLPVLAKIAGYANAGVDPAIMGIAPVSATRRCLDKAGWSLADLDLIEANEAF 320
146281079 241 SVTAGNASSLNDGAAAVLLMSAAKAKALGLSVLAKISAYANAGVDPAIMGIAPVSASRHCLDKAGWSLNELDLIEANEAF 320
146283545 241 CVTAGNASTLNDGAAAVVLMSASKAEALGLPVLAKIAGYANAGVDPAIMGIGPVTATRRCLEKAGWTLAELDLIEANEAF 320
28868177  241 TVTAGNASSLNDGAAAVMLMSATKAEQLGLPVLAHIAGYANAGVDPAIMGIGPVSATRRCLDKAGWSLDELDLIEANEAF 320
116049952 321 SAQSLAVGRELGWDAARVNVNGGAIALGHPIGASGCRVLVTLLHEMIRRDAKKGLATLCIGGGQGVALTLARD 393
15597197  321 AAQSLAVGRELGWDAARVNVNGGAIALGHPIGASGCRVLVTLLHEMIRRDAKKGLATLCIGGGQGVALTLARD 393
152986462 321 AAQSLAVGRELGWDAARVNVNGGAIALGHPIGASGCRVLVTLLHEMIRRDAKKGLATLCIGGGQGVALTLARD 393
218892041 321 AAQSLAVGRELGWDAARVNVNGGAIALGHPIGASGCRVLVTLLHEMIRRDAKKGLATLCIGGGQGVALTLARD 393
229589647 321 AAQSLAVGKELEWDTDKVNVNGGAIAIGHPIGASGCRVLVTLLHEMIKRDAKKGLATLCIGGGQGVALALERS 393
146308612 321 AAQALSVGQELGWNADKVNVNGGAIALGHPIGASGCRVLVTLLHEMIRRDAKKGLATLCIGGGQGVALAIERN 393
146306172 321 AAQALSVGQELGWDADKVNVNGGAIALGHPIGASGCRVLVTLLHEMIKRDAKKGLATLCIGGGQGVALAIERN 393
146281079 321 AVQALAVGQELGWDAAKVNVNGGAIALGHPIGASGCRVLVSLLHEMIRRDAKKGLATLCIGGGQGVALAIER- 392
146283545 321 AVQALSVGKELGWDADKVNVNGGAIALGHPIGASGCRILVTLLHEMQRRDARKGLATLCIGGGQGVALAVERP 393
28868177  321 AAQSLSVGKELGLDPQKLNVNGGAIAIGHPIGASGCRVLVTLLHEMIRRDAKKGLATLCIGGGQGVALALAR- 392
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap